Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DWD8

Protein Details
Accession A0A1Y2DWD8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-55VIYESRSTITRKRNKRKKRSHETSPKTALPHydrophilic
NLS Segment(s)
PositionSequence
36-45RKRNKRKKRS
Subcellular Location(s) mito 12.5, cyto_mito 10, cyto 6.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MISPRAHFGATLTPLRHSHILLESFVIYESRSTITRKRNKRKKRSHETSPKTALPVPLSDRLPLFKSVFLATGLSSTSAYKPGRQKPTLSAKTLPSAFRWDFVGRLFVGSGRTVAMGITRTGPRAPTPPNARIQQDEEVFVDDPGWTWPVGSLFVAPFEQALREVVHSIDRLVVGCHWQPSRLARRTGWMDLHWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.35
4 0.28
5 0.26
6 0.27
7 0.28
8 0.25
9 0.25
10 0.21
11 0.19
12 0.19
13 0.16
14 0.1
15 0.08
16 0.09
17 0.1
18 0.11
19 0.15
20 0.22
21 0.33
22 0.42
23 0.53
24 0.63
25 0.72
26 0.81
27 0.89
28 0.93
29 0.93
30 0.95
31 0.93
32 0.93
33 0.94
34 0.91
35 0.89
36 0.84
37 0.74
38 0.66
39 0.59
40 0.5
41 0.41
42 0.36
43 0.3
44 0.29
45 0.28
46 0.26
47 0.25
48 0.24
49 0.24
50 0.24
51 0.21
52 0.16
53 0.17
54 0.17
55 0.17
56 0.15
57 0.13
58 0.1
59 0.09
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.13
66 0.13
67 0.18
68 0.26
69 0.33
70 0.41
71 0.42
72 0.44
73 0.45
74 0.56
75 0.55
76 0.51
77 0.46
78 0.39
79 0.41
80 0.41
81 0.35
82 0.25
83 0.26
84 0.23
85 0.21
86 0.22
87 0.18
88 0.16
89 0.16
90 0.17
91 0.1
92 0.11
93 0.1
94 0.08
95 0.09
96 0.08
97 0.08
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.09
106 0.09
107 0.1
108 0.11
109 0.12
110 0.13
111 0.16
112 0.19
113 0.25
114 0.31
115 0.35
116 0.41
117 0.44
118 0.44
119 0.43
120 0.43
121 0.41
122 0.35
123 0.32
124 0.26
125 0.25
126 0.23
127 0.2
128 0.16
129 0.1
130 0.1
131 0.09
132 0.09
133 0.06
134 0.06
135 0.07
136 0.08
137 0.09
138 0.09
139 0.09
140 0.08
141 0.1
142 0.1
143 0.09
144 0.08
145 0.08
146 0.08
147 0.08
148 0.09
149 0.09
150 0.1
151 0.1
152 0.11
153 0.13
154 0.13
155 0.13
156 0.13
157 0.13
158 0.12
159 0.12
160 0.13
161 0.14
162 0.16
163 0.22
164 0.21
165 0.22
166 0.25
167 0.33
168 0.43
169 0.45
170 0.48
171 0.44
172 0.52
173 0.56
174 0.59
175 0.54