Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E0R7

Protein Details
Accession A0A1Y2E0R7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-42CDSKPFKRKADLQRHYRHRHCQDSHKKAYYBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences SESGLHICLASGCDSKPFKRKADLQRHYRHRHCQDSHKKAYYCDYPKCQRRSEPFHRLDHCRDHYREFHSEDLVRKNGKEGSDWFANRYFSRRWWRCTKCLQRNMTSDGWTCGTPGCQSHCDTRRRELRGYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.38
4 0.42
5 0.43
6 0.49
7 0.59
8 0.62
9 0.7
10 0.74
11 0.75
12 0.8
13 0.86
14 0.87
15 0.85
16 0.85
17 0.82
18 0.83
19 0.78
20 0.79
21 0.79
22 0.8
23 0.81
24 0.79
25 0.71
26 0.63
27 0.63
28 0.62
29 0.57
30 0.54
31 0.53
32 0.55
33 0.62
34 0.66
35 0.64
36 0.62
37 0.63
38 0.66
39 0.68
40 0.68
41 0.66
42 0.68
43 0.68
44 0.66
45 0.62
46 0.6
47 0.56
48 0.52
49 0.48
50 0.45
51 0.44
52 0.43
53 0.43
54 0.37
55 0.33
56 0.28
57 0.29
58 0.28
59 0.29
60 0.27
61 0.24
62 0.21
63 0.23
64 0.23
65 0.21
66 0.2
67 0.19
68 0.2
69 0.26
70 0.27
71 0.27
72 0.27
73 0.28
74 0.27
75 0.28
76 0.25
77 0.26
78 0.37
79 0.41
80 0.45
81 0.53
82 0.59
83 0.62
84 0.72
85 0.75
86 0.75
87 0.78
88 0.78
89 0.75
90 0.73
91 0.72
92 0.64
93 0.56
94 0.47
95 0.41
96 0.35
97 0.28
98 0.23
99 0.18
100 0.17
101 0.16
102 0.17
103 0.2
104 0.21
105 0.24
106 0.34
107 0.41
108 0.47
109 0.5
110 0.56
111 0.6
112 0.63