Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2E7T3

Protein Details
Accession A0A1Y2E7T3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-45QEKSKVPKGRAKKRLQYTRRFVHydrophilic
NLS Segment(s)
PositionSequence
24-37QEKSKVPKGRAKKR
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEAQEKSKVPKGRAKKRLQYTRRFVNVQLTGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.45
5 0.46
6 0.52
7 0.51
8 0.55
9 0.51
10 0.5
11 0.5
12 0.49
13 0.49
14 0.49
15 0.48
16 0.43
17 0.47
18 0.52
19 0.54
20 0.61
21 0.65
22 0.68
23 0.74
24 0.82
25 0.83
26 0.83
27 0.8
28 0.79
29 0.77
30 0.7
31 0.61
32 0.59
33 0.53
34 0.46
35 0.45
36 0.39
37 0.39
38 0.39
39 0.42
40 0.37
41 0.43
42 0.5
43 0.53