Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2D856

Protein Details
Accession A0A1Y2D856   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MLPLRQKRLIRARTTKRTSCNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
Amino Acid Sequences MLPLRQKRLIRARTTKRTSCNDTFDDLIQGKDKRCIFLLHGEPGIGKTFTAESIADDIKRPLYVMMSGELGLDVKSLDQSLGRFSTTLSSLESISPSNTDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.8
4 0.79
5 0.78
6 0.73
7 0.69
8 0.6
9 0.55
10 0.5
11 0.42
12 0.39
13 0.3
14 0.25
15 0.24
16 0.24
17 0.21
18 0.26
19 0.26
20 0.23
21 0.24
22 0.24
23 0.22
24 0.27
25 0.3
26 0.26
27 0.25
28 0.23
29 0.22
30 0.21
31 0.2
32 0.12
33 0.08
34 0.06
35 0.06
36 0.07
37 0.08
38 0.07
39 0.06
40 0.08
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.07
49 0.07
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.08
56 0.08
57 0.07
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.07
67 0.1
68 0.12
69 0.12
70 0.12
71 0.12
72 0.15
73 0.15
74 0.16
75 0.14
76 0.14
77 0.14
78 0.16
79 0.17
80 0.14
81 0.14