Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EZS1

Protein Details
Accession H0EZS1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-32EESLEPPERPRKPRRKYISALKNLKEHydrophilic
NLS Segment(s)
PositionSequence
15-22RPRKPRRK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MFYHDEEESLEPPERPRKPRRKYISALKNLKEQYQPEAEWLLQEDGDPSHGKRKIGLATQLKEREGIKSLYYPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.52
4 0.59
5 0.66
6 0.76
7 0.8
8 0.8
9 0.81
10 0.83
11 0.83
12 0.83
13 0.82
14 0.73
15 0.71
16 0.63
17 0.58
18 0.51
19 0.41
20 0.35
21 0.3
22 0.28
23 0.22
24 0.22
25 0.19
26 0.15
27 0.15
28 0.12
29 0.08
30 0.08
31 0.07
32 0.06
33 0.08
34 0.09
35 0.09
36 0.16
37 0.19
38 0.2
39 0.21
40 0.25
41 0.28
42 0.32
43 0.4
44 0.41
45 0.42
46 0.5
47 0.52
48 0.48
49 0.46
50 0.42
51 0.36
52 0.32
53 0.3
54 0.24