Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E1C4

Protein Details
Accession A0A1Y2E1C4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-68ADSERTPDGRRRRRRRAEPAEVKNGIBasic
NLS Segment(s)
PositionSequence
51-59GRRRRRRRA
Subcellular Location(s) mito 12, plas 7, E.R. 3, extr 2, golg 2
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRMTSSLFATTVVASFFVVALPHMLPCPAPRVKYADSERTPDGRRRRRRRAEPAEVKNGIAQFESSNEDFDRAFKATKPARPCPIPKPGGVVGELMGFKKSKTESEQSQGQNER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.26
6 0.21
7 0.14
8 0.11
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.14
23 0.15
24 0.16
25 0.18
26 0.24
27 0.26
28 0.34
29 0.38
30 0.41
31 0.4
32 0.43
33 0.43
34 0.42
35 0.43
36 0.42
37 0.48
38 0.49
39 0.58
40 0.64
41 0.73
42 0.78
43 0.85
44 0.89
45 0.89
46 0.89
47 0.89
48 0.84
49 0.81
50 0.71
51 0.61
52 0.52
53 0.42
54 0.31
55 0.21
56 0.16
57 0.08
58 0.09
59 0.12
60 0.1
61 0.11
62 0.11
63 0.12
64 0.11
65 0.12
66 0.13
67 0.11
68 0.12
69 0.12
70 0.2
71 0.25
72 0.31
73 0.37
74 0.42
75 0.48
76 0.53
77 0.57
78 0.55
79 0.6
80 0.57
81 0.5
82 0.5
83 0.45
84 0.41
85 0.36
86 0.3
87 0.21
88 0.21
89 0.21
90 0.15
91 0.14
92 0.12
93 0.11
94 0.16
95 0.17
96 0.19
97 0.26
98 0.33
99 0.37
100 0.44
101 0.53
102 0.52