Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2E3S1

Protein Details
Accession A0A1Y2E3S1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-70LTASSCIRSRRQRRRGVQPMYGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 6, extr 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MAPVVDLLKRQSRCPSGQYYRNGYCYSSWAWYGRWIFAAVVIAVIIIILTASSCIRSRRQRRRGVQPMYGMGWMAPPQNYNNAAPPAYGAQNQSYPMNNQPQYTGNTFNTNDGYYGHHEGIAPPKNVYTNDNRNETYAPPEGPPPGKTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.54
4 0.6
5 0.64
6 0.64
7 0.62
8 0.62
9 0.58
10 0.49
11 0.41
12 0.37
13 0.32
14 0.26
15 0.24
16 0.21
17 0.21
18 0.26
19 0.27
20 0.24
21 0.23
22 0.21
23 0.18
24 0.17
25 0.18
26 0.11
27 0.09
28 0.08
29 0.06
30 0.05
31 0.05
32 0.03
33 0.02
34 0.02
35 0.01
36 0.02
37 0.02
38 0.03
39 0.04
40 0.06
41 0.09
42 0.16
43 0.27
44 0.38
45 0.48
46 0.58
47 0.67
48 0.73
49 0.82
50 0.85
51 0.81
52 0.76
53 0.67
54 0.59
55 0.5
56 0.43
57 0.31
58 0.21
59 0.15
60 0.11
61 0.09
62 0.07
63 0.07
64 0.07
65 0.11
66 0.13
67 0.13
68 0.15
69 0.15
70 0.15
71 0.14
72 0.14
73 0.13
74 0.12
75 0.13
76 0.12
77 0.12
78 0.13
79 0.14
80 0.15
81 0.14
82 0.15
83 0.18
84 0.25
85 0.25
86 0.24
87 0.25
88 0.26
89 0.29
90 0.3
91 0.3
92 0.24
93 0.27
94 0.27
95 0.27
96 0.26
97 0.23
98 0.21
99 0.17
100 0.18
101 0.17
102 0.2
103 0.19
104 0.18
105 0.17
106 0.19
107 0.27
108 0.3
109 0.27
110 0.24
111 0.25
112 0.27
113 0.29
114 0.32
115 0.32
116 0.36
117 0.41
118 0.46
119 0.46
120 0.45
121 0.46
122 0.43
123 0.39
124 0.34
125 0.29
126 0.25
127 0.27
128 0.3
129 0.32
130 0.31