FuNGI

A0A1Y2E7T1

Protein Details

Accession

A0A1Y2E7T1

Localization Confidence

High

Confidence Score

16.5

NoLS Segment(s)

Position	Sequence	Protein Nature
73-98	TPAPEGSEKKTKKRKSWGQVLPEPKT	Hydrophilic

NLS Segment(s)

Position	Sequence
80-135	EKKTKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKR

Subcellular Location(s)

nucl 22, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR004827 bZIP IPR046347 bZIP_sf IPR044280 Hac1/HY5
Gene Ontology	GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0006986 P:response to unfolded protein
Pfam	View protein in Pfam PF07716 bZIP_2
PROSITE	View protein in PROSITE PS50217 BZIP
CDD	cd14710 bZIP_HAC1-like

Amino Acid Sequences

MTSWDNKTSMSTPQVKFEESPAESFVSTPGGDMYPLFESSSAANTMNPMESVMTPRSFSEDGINSPAGDDNGTPAPEGSEKKTKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKRQEVEALEKRNKELEDLLLHQQEQNLMLMDELNRFRRSSGSARGSSPLDALQPTPITLSQPLFGSQSNPESKSGMMNDFILIPEQAPTVDPASLSPELTPIPDVKVMPITSSATVAPVKPNTSASTSTDMTQHPAAMLCDLQCQSVEVPQSWTASQKRSQPALALYLQLQLLLTAFSTLLSACRDPLKLIAGSLKHNLALTATPSITSTIIWMVTLPPNHRISTSISSLVTIMPAQLQARWQETSRWPTSSSPATASLTLRIKSLQKLLTSSPNLARPLKDATMGFLRLVSEGRDDRVEGPADGSPGIKGDQDRGPLLWPDGASLPSREVLLTLLWAIRVEERKMHEATREATIVSRQPAPAVRPASLSVSTENQTNQNSILLAAPKRKREMDADKGSKRLRLGY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.47
3	0.46
4	0.43
5	0.44
6	0.36
7	0.37
8	0.31
9	0.3
10	0.27
11	0.26
12	0.23
13	0.17
14	0.15
15	0.13
16	0.13
17	0.11
18	0.11
19	0.11
20	0.13
21	0.12
22	0.13
23	0.13
24	0.12
25	0.12
26	0.13
27	0.16
28	0.15
29	0.13
30	0.13
31	0.14
32	0.15
33	0.15
34	0.14
35	0.12
36	0.12
37	0.12
38	0.17
39	0.19
40	0.19
41	0.19
42	0.19
43	0.25
44	0.23
45	0.23
46	0.26
47	0.24
48	0.26
49	0.29
50	0.3
51	0.24
52	0.24
53	0.24
54	0.18
55	0.15
56	0.13
57	0.11
58	0.14
59	0.14
60	0.14
61	0.12
62	0.14
63	0.17
64	0.2
65	0.23
66	0.31
67	0.36
68	0.46
69	0.57
70	0.64
71	0.69
72	0.78
73	0.82
74	0.82
75	0.88
76	0.86
77	0.86
78	0.85
79	0.84
80	0.78
81	0.73
82	0.66
83	0.57
84	0.57
85	0.56
86	0.58
87	0.56
88	0.62
89	0.65
90	0.72
91	0.77
92	0.75
93	0.76
94	0.78
95	0.77
96	0.78
97	0.79
98	0.76
99	0.76
100	0.77
101	0.71
102	0.64
103	0.62
104	0.59
105	0.58
106	0.61
107	0.66
108	0.66
109	0.7
110	0.72
111	0.73
112	0.73
113	0.67
114	0.65
115	0.65
116	0.67
117	0.69
118	0.73
119	0.7
120	0.67
121	0.67
122	0.65
123	0.62
124	0.6
125	0.6
126	0.6
127	0.65
128	0.66
129	0.63
130	0.57
131	0.53
132	0.45
133	0.37
134	0.3
135	0.25
136	0.23
137	0.25
138	0.29
139	0.26
140	0.26
141	0.25
142	0.23
143	0.2
144	0.17
145	0.14
146	0.1
147	0.09
148	0.08
149	0.08
150	0.09
151	0.12
152	0.14
153	0.17
154	0.18
155	0.18
156	0.19
157	0.2
158	0.24
159	0.25
160	0.32
161	0.36
162	0.37
163	0.38
164	0.4
165	0.39
166	0.35
167	0.3
168	0.21
169	0.15
170	0.14
171	0.13
172	0.12
173	0.11
174	0.1
175	0.11
176	0.1
177	0.1
178	0.12
179	0.12
180	0.11
181	0.11
182	0.12
183	0.13
184	0.12
185	0.13
186	0.13
187	0.18
188	0.2
189	0.21
190	0.21
191	0.2
192	0.21
193	0.21
194	0.21
195	0.16
196	0.14
197	0.13
198	0.12
199	0.12
200	0.11
201	0.09
202	0.07
203	0.06
204	0.06
205	0.06
206	0.05
207	0.05
208	0.06
209	0.07
210	0.07
211	0.07
212	0.06
213	0.11
214	0.11
215	0.11
216	0.1
217	0.1
218	0.1
219	0.1
220	0.11
221	0.07
222	0.08
223	0.1
224	0.1
225	0.09
226	0.12
227	0.12
228	0.11
229	0.12
230	0.12
231	0.1
232	0.11
233	0.1
234	0.09
235	0.1
236	0.1
237	0.11
238	0.11
239	0.12
240	0.12
241	0.13
242	0.13
243	0.15
244	0.17
245	0.17
246	0.2
247	0.19
248	0.19
249	0.21
250	0.19
251	0.19
252	0.17
253	0.15
254	0.1
255	0.1
256	0.1
257	0.07
258	0.08
259	0.06
260	0.08
261	0.08
262	0.08
263	0.07
264	0.08
265	0.08
266	0.1
267	0.1
268	0.08
269	0.1
270	0.11
271	0.13
272	0.12
273	0.17
274	0.17
275	0.19
276	0.23
277	0.27
278	0.31
279	0.32
280	0.32
281	0.29
282	0.28
283	0.29
284	0.26
285	0.2
286	0.15
287	0.15
288	0.14
289	0.12
290	0.11
291	0.07
292	0.06
293	0.05
294	0.05
295	0.03
296	0.03
297	0.03
298	0.04
299	0.04
300	0.05
301	0.06
302	0.07
303	0.07
304	0.09
305	0.1
306	0.1
307	0.11
308	0.13
309	0.11
310	0.12
311	0.15
312	0.15
313	0.17
314	0.18
315	0.17
316	0.15
317	0.15
318	0.14
319	0.11
320	0.1
321	0.09
322	0.1
323	0.09
324	0.09
325	0.09
326	0.1
327	0.09
328	0.09
329	0.08
330	0.07
331	0.07
332	0.07
333	0.06
334	0.07
335	0.1
336	0.13
337	0.14
338	0.18
339	0.21
340	0.21
341	0.22
342	0.22
343	0.24
344	0.26
345	0.27
346	0.24
347	0.21
348	0.21
349	0.21
350	0.19
351	0.14
352	0.1
353	0.08
354	0.06
355	0.07
356	0.07
357	0.08
358	0.1
359	0.12
360	0.14
361	0.16
362	0.16
363	0.2
364	0.26
365	0.33
366	0.34
367	0.34
368	0.33
369	0.33
370	0.38
371	0.36
372	0.32
373	0.26
374	0.26
375	0.26
376	0.26
377	0.25
378	0.26
379	0.26
380	0.24
381	0.23
382	0.22
383	0.24
384	0.25
385	0.3
386	0.27
387	0.25
388	0.28
389	0.3
390	0.36
391	0.35
392	0.36
393	0.34
394	0.35
395	0.38
396	0.37
397	0.35
398	0.3
399	0.32
400	0.3
401	0.29
402	0.24
403	0.23
404	0.26
405	0.26
406	0.23
407	0.19
408	0.18
409	0.15
410	0.16
411	0.14
412	0.14
413	0.14
414	0.16
415	0.16
416	0.17
417	0.18
418	0.21
419	0.21
420	0.16
421	0.17
422	0.17
423	0.17
424	0.16
425	0.15
426	0.11
427	0.11
428	0.11
429	0.11
430	0.11
431	0.14
432	0.18
433	0.2
434	0.22
435	0.21
436	0.23
437	0.22
438	0.23
439	0.21
440	0.17
441	0.16
442	0.16
443	0.17
444	0.16
445	0.16
446	0.16
447	0.14
448	0.15
449	0.13
450	0.12
451	0.11
452	0.1
453	0.09
454	0.09
455	0.09
456	0.09
457	0.09
458	0.1
459	0.14
460	0.18
461	0.19
462	0.23
463	0.28
464	0.33
465	0.35
466	0.36
467	0.35
468	0.35
469	0.36
470	0.35
471	0.31
472	0.27
473	0.26
474	0.28
475	0.28
476	0.26
477	0.27
478	0.23
479	0.25
480	0.29
481	0.31
482	0.35
483	0.34
484	0.32
485	0.3
486	0.32
487	0.33
488	0.31
489	0.29
490	0.25
491	0.26
492	0.26
493	0.26
494	0.27
495	0.27
496	0.27
497	0.27
498	0.25
499	0.22
500	0.21
501	0.19
502	0.21
503	0.21
504	0.24
505	0.32
506	0.38
507	0.43
508	0.49
509	0.51
510	0.51
511	0.55
512	0.6
513	0.61
514	0.66
515	0.7
516	0.68
517	0.73
518	0.72
519	0.67

A0A1Y2E7T1

3D AlphaFold-predicted Structure Viewer