Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DCY4

Protein Details
Accession A0A1Y2DCY4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-91LKAVPKKKTSHMKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
73-87PKKKTSHMKKRHRQM
Subcellular Location(s) mito 24, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAIQQLRMASAVSSLFPRLASTTYASPFRTSVWFGQQSLPSIPQLAVAIPAALQTIPGFLGEIWDGILKAVPKKKTSHMKKRHRQMAGKALKDVTALNKCPACGQTKKMHTLCPHCMGKIQGMFPNTSKQYGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.12
6 0.12
7 0.12
8 0.13
9 0.15
10 0.18
11 0.21
12 0.24
13 0.24
14 0.24
15 0.23
16 0.23
17 0.22
18 0.22
19 0.21
20 0.26
21 0.27
22 0.27
23 0.31
24 0.31
25 0.31
26 0.3
27 0.28
28 0.2
29 0.18
30 0.17
31 0.13
32 0.12
33 0.09
34 0.08
35 0.07
36 0.07
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.09
58 0.14
59 0.16
60 0.19
61 0.22
62 0.3
63 0.4
64 0.49
65 0.57
66 0.63
67 0.72
68 0.79
69 0.87
70 0.88
71 0.85
72 0.81
73 0.77
74 0.77
75 0.75
76 0.67
77 0.59
78 0.5
79 0.43
80 0.37
81 0.3
82 0.26
83 0.24
84 0.23
85 0.25
86 0.26
87 0.26
88 0.27
89 0.29
90 0.28
91 0.26
92 0.3
93 0.36
94 0.41
95 0.5
96 0.5
97 0.54
98 0.55
99 0.59
100 0.6
101 0.6
102 0.56
103 0.47
104 0.49
105 0.44
106 0.44
107 0.41
108 0.37
109 0.33
110 0.32
111 0.35
112 0.33
113 0.4
114 0.35