Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DF14

Protein Details
Accession A0A1Y2DF14    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-101HSSVKRRCEHCKVVRRKANKRHRGYIYIBasic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MTTKLLLSSMRALSLRTGKPAAPYAAIRTKQSVRSISYALPGLKTSTRPTTTAVMGAVKAVAAVKQQMRGMKVHSSVKRRCEHCKVVRRKANKRHRGYIYIICSANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.29
5 0.27
6 0.31
7 0.34
8 0.31
9 0.25
10 0.25
11 0.27
12 0.34
13 0.34
14 0.32
15 0.33
16 0.36
17 0.38
18 0.41
19 0.39
20 0.34
21 0.35
22 0.35
23 0.31
24 0.29
25 0.27
26 0.23
27 0.2
28 0.17
29 0.16
30 0.15
31 0.16
32 0.17
33 0.2
34 0.21
35 0.22
36 0.24
37 0.24
38 0.23
39 0.22
40 0.19
41 0.14
42 0.12
43 0.11
44 0.08
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.06
51 0.07
52 0.1
53 0.12
54 0.14
55 0.16
56 0.16
57 0.19
58 0.2
59 0.24
60 0.29
61 0.34
62 0.41
63 0.44
64 0.52
65 0.57
66 0.57
67 0.61
68 0.62
69 0.66
70 0.67
71 0.73
72 0.75
73 0.78
74 0.82
75 0.84
76 0.86
77 0.87
78 0.88
79 0.88
80 0.86
81 0.85
82 0.83
83 0.79
84 0.74
85 0.72
86 0.67
87 0.62
88 0.54
89 0.45
90 0.42
91 0.41
92 0.45
93 0.46
94 0.49