Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DZQ1

Protein Details
Accession A0A1Y2DZQ1   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
213-236EQGCRVRIRRDVRMRRREGKTSNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8.5, cyto_mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021740  Velvet  
IPR037525  Velvet_dom  
IPR038491  Velvet_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
Pfam View protein in Pfam  
PF11754  Velvet  
PROSITE View protein in PROSITE  
PS51821  VELVET  
Amino Acid Sequences MATTTTISDESWGRVSRRTASGKTLHYVLRVLQQPERARACGSGPKSSADRRPVDPPPIVQLHIYEGENPHTAKDVTFDYNAFFFLYVSLENARPIAHGRVQTPAATSPPVLTGMPVSGCAYLDRPDPAGYFLFPDLSVRHEGPYRLSFELYEQRKERGDFDLPDPTANPEVLEEDECFNHVLGIKSQKFHVFSAKKFPGLAESTALSRTIAEQGCRVRIRRDVRMRRREGKTSNNDEFEQAQQDELARQRRTQSPADVYRARSASNSSMDRAPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.35
4 0.42
5 0.46
6 0.44
7 0.47
8 0.53
9 0.51
10 0.51
11 0.49
12 0.43
13 0.37
14 0.35
15 0.3
16 0.31
17 0.33
18 0.33
19 0.32
20 0.38
21 0.41
22 0.47
23 0.49
24 0.43
25 0.38
26 0.36
27 0.37
28 0.37
29 0.36
30 0.35
31 0.32
32 0.34
33 0.38
34 0.43
35 0.46
36 0.46
37 0.47
38 0.44
39 0.5
40 0.51
41 0.53
42 0.49
43 0.43
44 0.41
45 0.39
46 0.37
47 0.3
48 0.25
49 0.23
50 0.23
51 0.22
52 0.17
53 0.16
54 0.18
55 0.2
56 0.19
57 0.17
58 0.16
59 0.16
60 0.14
61 0.15
62 0.15
63 0.15
64 0.16
65 0.16
66 0.15
67 0.15
68 0.15
69 0.13
70 0.1
71 0.07
72 0.07
73 0.07
74 0.06
75 0.07
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.1
83 0.12
84 0.14
85 0.16
86 0.17
87 0.2
88 0.21
89 0.2
90 0.2
91 0.18
92 0.15
93 0.14
94 0.13
95 0.1
96 0.1
97 0.11
98 0.09
99 0.08
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.06
106 0.06
107 0.07
108 0.07
109 0.08
110 0.09
111 0.09
112 0.09
113 0.1
114 0.1
115 0.11
116 0.1
117 0.09
118 0.09
119 0.09
120 0.08
121 0.07
122 0.08
123 0.07
124 0.08
125 0.11
126 0.1
127 0.11
128 0.12
129 0.12
130 0.15
131 0.17
132 0.18
133 0.16
134 0.16
135 0.15
136 0.16
137 0.25
138 0.24
139 0.27
140 0.25
141 0.26
142 0.29
143 0.29
144 0.28
145 0.24
146 0.26
147 0.23
148 0.24
149 0.29
150 0.27
151 0.26
152 0.25
153 0.23
154 0.2
155 0.18
156 0.15
157 0.08
158 0.09
159 0.1
160 0.11
161 0.09
162 0.09
163 0.09
164 0.1
165 0.1
166 0.09
167 0.09
168 0.09
169 0.09
170 0.11
171 0.2
172 0.21
173 0.22
174 0.24
175 0.27
176 0.28
177 0.27
178 0.35
179 0.31
180 0.31
181 0.41
182 0.42
183 0.39
184 0.37
185 0.36
186 0.31
187 0.29
188 0.28
189 0.19
190 0.17
191 0.17
192 0.18
193 0.18
194 0.13
195 0.1
196 0.1
197 0.14
198 0.15
199 0.15
200 0.19
201 0.22
202 0.29
203 0.32
204 0.33
205 0.31
206 0.38
207 0.44
208 0.5
209 0.58
210 0.62
211 0.7
212 0.78
213 0.83
214 0.85
215 0.85
216 0.84
217 0.8
218 0.8
219 0.79
220 0.78
221 0.76
222 0.7
223 0.64
224 0.57
225 0.52
226 0.44
227 0.38
228 0.29
229 0.23
230 0.19
231 0.19
232 0.21
233 0.25
234 0.31
235 0.28
236 0.3
237 0.36
238 0.42
239 0.47
240 0.49
241 0.5
242 0.51
243 0.57
244 0.62
245 0.61
246 0.58
247 0.6
248 0.56
249 0.48
250 0.41
251 0.38
252 0.36
253 0.38
254 0.37
255 0.33