Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2D786

Protein Details
Accession A0A1Y2D786    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-36AFLPRKRAARHRGKVKSFPKDDBasic
NLS Segment(s)
PositionSequence
17-39LPRKRAARHRGKVKSFPKDDPKK
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045077  L3_arc_euk  
IPR000597  Ribosomal_L3  
IPR044892  Ribosomal_L3_dom_3_arc_sf  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
Amino Acid Sequences MSHRKFEAPRHGSLAFLPRKRAARHRGKVKSFPKDDPKKPVHLTATMGYKAGMTTIVRDLDRPGAKSHKKEVVEAVTIIDTPPVRTTQPAWLCAYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.39
4 0.39
5 0.39
6 0.45
7 0.49
8 0.56
9 0.57
10 0.6
11 0.67
12 0.73
13 0.77
14 0.78
15 0.83
16 0.83
17 0.82
18 0.76
19 0.74
20 0.74
21 0.74
22 0.72
23 0.71
24 0.66
25 0.63
26 0.6
27 0.58
28 0.5
29 0.42
30 0.39
31 0.33
32 0.33
33 0.26
34 0.24
35 0.18
36 0.15
37 0.13
38 0.11
39 0.09
40 0.05
41 0.06
42 0.08
43 0.1
44 0.1
45 0.11
46 0.12
47 0.18
48 0.19
49 0.19
50 0.21
51 0.29
52 0.34
53 0.38
54 0.43
55 0.44
56 0.43
57 0.44
58 0.46
59 0.41
60 0.38
61 0.34
62 0.29
63 0.21
64 0.2
65 0.18
66 0.16
67 0.11
68 0.11
69 0.12
70 0.13
71 0.14
72 0.16
73 0.19
74 0.26
75 0.31
76 0.34