Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DT90

Protein Details
Accession A0A1Y2DT90   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-59LIFLHLRRRSRDKREWPKDPQELHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, golg 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
CDD cd12087  TM_EGFR-like  
Amino Acid Sequences MTNPLVLREKPYVSSNLTAIVLGTVSGLVIVILFSTLIFLHLRRRSRDKREWPKDPQELEDYGIDPSQVKPPQKAYQQSGTNQKPFVPPGGGSSRESLNSLARDIQDNPFGPKAEIISGDSKAAEASQRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.26
4 0.24
5 0.21
6 0.18
7 0.14
8 0.1
9 0.07
10 0.07
11 0.04
12 0.03
13 0.03
14 0.03
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.03
23 0.03
24 0.05
25 0.05
26 0.06
27 0.15
28 0.2
29 0.25
30 0.3
31 0.4
32 0.48
33 0.57
34 0.67
35 0.7
36 0.76
37 0.81
38 0.84
39 0.82
40 0.82
41 0.8
42 0.71
43 0.62
44 0.54
45 0.45
46 0.39
47 0.31
48 0.22
49 0.16
50 0.14
51 0.11
52 0.08
53 0.08
54 0.13
55 0.16
56 0.16
57 0.18
58 0.23
59 0.29
60 0.35
61 0.39
62 0.37
63 0.42
64 0.45
65 0.47
66 0.52
67 0.51
68 0.48
69 0.44
70 0.41
71 0.35
72 0.32
73 0.3
74 0.22
75 0.17
76 0.19
77 0.24
78 0.24
79 0.23
80 0.24
81 0.23
82 0.22
83 0.23
84 0.2
85 0.19
86 0.18
87 0.18
88 0.18
89 0.18
90 0.2
91 0.21
92 0.23
93 0.24
94 0.25
95 0.27
96 0.28
97 0.28
98 0.25
99 0.24
100 0.23
101 0.19
102 0.19
103 0.18
104 0.19
105 0.19
106 0.19
107 0.18
108 0.16
109 0.15
110 0.14