Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EE56

Protein Details
Accession A0A1Y2EE56    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
18-43LWKIPWRLSRFQKARQRKRLRAVDSVHydrophilic
79-105KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
86-98KEKRYRKGIHKLP
Subcellular Location(s) mito 22, cyto_mito 12.666, mito_nucl 12.666, cyto_nucl 2.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGFGAFRATSPLSGGLLWKIPWRLSRFQKARQRKRLRAVDSVVATLDSALKKQGQSLRSLEVWKEEMPTEAEMLPKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.12
4 0.13
5 0.14
6 0.16
7 0.17
8 0.19
9 0.25
10 0.29
11 0.36
12 0.42
13 0.52
14 0.56
15 0.63
16 0.71
17 0.76
18 0.82
19 0.84
20 0.87
21 0.85
22 0.88
23 0.88
24 0.83
25 0.78
26 0.71
27 0.65
28 0.55
29 0.47
30 0.37
31 0.27
32 0.21
33 0.15
34 0.13
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.12
41 0.17
42 0.16
43 0.19
44 0.21
45 0.22
46 0.23
47 0.24
48 0.2
49 0.18
50 0.19
51 0.16
52 0.15
53 0.13
54 0.12
55 0.13
56 0.13
57 0.12
58 0.11
59 0.12
60 0.11
61 0.12
62 0.12
63 0.11
64 0.12
65 0.11
66 0.14
67 0.18
68 0.27
69 0.29
70 0.38
71 0.45
72 0.54
73 0.63
74 0.69
75 0.7
76 0.71
77 0.77
78 0.78
79 0.83
80 0.82
81 0.83
82 0.83
83 0.87
84 0.86
85 0.87
86 0.82
87 0.8
88 0.8
89 0.79
90 0.8
91 0.77
92 0.79