Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DFL4

Protein Details
Accession A0A1Y2DFL4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-33LIKLGASSKIPKRKKKTKGGRLTPGSPKCHydrophilic
NLS Segment(s)
PositionSequence
12-28SKIPKRKKKTKGGRLTP
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MCCNLIKLGASSKIPKRKKKTKGGRLTPGSPKCESKRIRLDPNLPLSKAHTSDEASFDGMVQGKGKCLEGLLNGPPETGKTATAEIEAEASNWPLYVVTTNELDPYAQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.69
4 0.75
5 0.82
6 0.86
7 0.88
8 0.89
9 0.91
10 0.91
11 0.91
12 0.87
13 0.84
14 0.83
15 0.77
16 0.71
17 0.62
18 0.59
19 0.53
20 0.55
21 0.51
22 0.5
23 0.55
24 0.57
25 0.63
26 0.62
27 0.64
28 0.61
29 0.67
30 0.61
31 0.51
32 0.44
33 0.39
34 0.35
35 0.31
36 0.26
37 0.18
38 0.17
39 0.17
40 0.19
41 0.16
42 0.14
43 0.12
44 0.11
45 0.1
46 0.09
47 0.08
48 0.08
49 0.07
50 0.08
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.11
58 0.13
59 0.15
60 0.14
61 0.14
62 0.14
63 0.14
64 0.15
65 0.13
66 0.11
67 0.1
68 0.12
69 0.12
70 0.13
71 0.13
72 0.1
73 0.11
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.08
81 0.06
82 0.07
83 0.09
84 0.1
85 0.11
86 0.13
87 0.14
88 0.15
89 0.15