Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EJG0

Protein Details
Accession A0A1Y2EJG0    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-43AKSARIKKSKKAPQTKFKVRCSKLHydrophilic
62-82LPPNLQIKEVPKKNKKGKHTAHydrophilic
NLS Segment(s)
PositionSequence
21-32KSARIKKSKKAP
72-80PKKNKKGKH
Subcellular Location(s) nucl 20, cyto_nucl 15.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKEIADIKQFIEICRREDAKSARIKKSKKAPQTKFKVRCSKLLYTLVLKDSDKAEKLKQSLPPNLQIKEVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.35
4 0.31
5 0.38
6 0.41
7 0.4
8 0.48
9 0.52
10 0.55
11 0.61
12 0.63
13 0.64
14 0.7
15 0.71
16 0.72
17 0.75
18 0.75
19 0.77
20 0.84
21 0.87
22 0.85
23 0.85
24 0.85
25 0.76
26 0.74
27 0.7
28 0.63
29 0.57
30 0.52
31 0.45
32 0.36
33 0.36
34 0.3
35 0.26
36 0.22
37 0.19
38 0.17
39 0.18
40 0.18
41 0.19
42 0.21
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.46
49 0.48
50 0.53
51 0.54
52 0.52
53 0.49
54 0.46
55 0.46
56 0.49
57 0.53
58 0.55
59 0.59
60 0.68
61 0.76
62 0.81