Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EWC0

Protein Details
Accession H0EWC0   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-31GVITSSRCDHCRKRKKKCDEKRPACTRCIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, mito 9, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MVGVITSSRCDHCRKRKKKCDEKRPACTRCIQAGLICSGFITRWKFVDEAARVAGQYVGRQFVFDTVDEGLESIFEKYEDEKFQTDGTLQATLLKGSIVDSAVSRVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.75
3 0.82
4 0.9
5 0.94
6 0.95
7 0.95
8 0.95
9 0.95
10 0.94
11 0.94
12 0.87
13 0.8
14 0.75
15 0.68
16 0.61
17 0.54
18 0.44
19 0.34
20 0.32
21 0.3
22 0.24
23 0.18
24 0.14
25 0.1
26 0.1
27 0.13
28 0.14
29 0.12
30 0.13
31 0.15
32 0.15
33 0.15
34 0.23
35 0.19
36 0.18
37 0.18
38 0.17
39 0.15
40 0.16
41 0.16
42 0.09
43 0.09
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.1
53 0.08
54 0.09
55 0.08
56 0.08
57 0.06
58 0.05
59 0.06
60 0.05
61 0.04
62 0.04
63 0.05
64 0.07
65 0.11
66 0.13
67 0.16
68 0.17
69 0.18
70 0.18
71 0.18
72 0.17
73 0.15
74 0.15
75 0.13
76 0.12
77 0.14
78 0.14
79 0.13
80 0.13
81 0.11
82 0.09
83 0.09
84 0.1
85 0.08
86 0.08
87 0.09