Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EHX4

Protein Details
Accession A0A1Y2EHX4    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
22-41RPASCSVRTRKVRSNRWRSMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 6, cyto_nucl 5.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MVQRNTRAFITLFPVDIDNPRRPASCSVRTRKVRSNRWRSMLSTTHGDIRKACKVVQLLHRTQIGRPLKDTAVDEFSIFLVHVHLCVLYPGHRNHAAERRRTMSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.24
4 0.28
5 0.26
6 0.28
7 0.3
8 0.3
9 0.32
10 0.39
11 0.41
12 0.45
13 0.5
14 0.55
15 0.63
16 0.69
17 0.73
18 0.74
19 0.76
20 0.77
21 0.78
22 0.8
23 0.78
24 0.76
25 0.73
26 0.66
27 0.63
28 0.56
29 0.47
30 0.4
31 0.33
32 0.34
33 0.32
34 0.3
35 0.26
36 0.26
37 0.28
38 0.25
39 0.24
40 0.21
41 0.22
42 0.26
43 0.33
44 0.35
45 0.32
46 0.34
47 0.38
48 0.35
49 0.33
50 0.37
51 0.35
52 0.29
53 0.29
54 0.29
55 0.26
56 0.28
57 0.29
58 0.23
59 0.21
60 0.2
61 0.18
62 0.15
63 0.15
64 0.13
65 0.11
66 0.08
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.08
75 0.1
76 0.16
77 0.18
78 0.24
79 0.29
80 0.3
81 0.37
82 0.45
83 0.49
84 0.51
85 0.57
86 0.55