Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DJR0

Protein Details
Accession A0A1Y2DJR0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-67YVAREKSSEKKHKKGKWGGCCDLHydrophilic
NLS Segment(s)
PositionSequence
53-60EKKHKKGK
Subcellular Location(s) nucl 11, cyto_nucl 9, mito 7, cyto 5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028144  CYSTM_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12734  CYSTM  
Amino Acid Sequences MSHSTHYPVQPSYAQAPPTSYQPNYTQQDGYTPNVHMNAQQQMGYVAREKSSEKKHKKGKWGGCCDLECLACLCCCCCDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.28
4 0.26
5 0.29
6 0.3
7 0.26
8 0.26
9 0.29
10 0.37
11 0.36
12 0.37
13 0.33
14 0.28
15 0.32
16 0.31
17 0.3
18 0.23
19 0.2
20 0.19
21 0.19
22 0.19
23 0.16
24 0.16
25 0.16
26 0.14
27 0.14
28 0.12
29 0.12
30 0.13
31 0.12
32 0.12
33 0.09
34 0.09
35 0.11
36 0.13
37 0.19
38 0.29
39 0.39
40 0.45
41 0.54
42 0.64
43 0.69
44 0.78
45 0.81
46 0.81
47 0.8
48 0.82
49 0.78
50 0.74
51 0.68
52 0.6
53 0.53
54 0.44
55 0.34
56 0.26
57 0.21
58 0.16
59 0.16
60 0.14
61 0.12