Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2E3I9

Protein Details
Accession A0A1Y2E3I9    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31PKETTKRGKAGKVEKRKTKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
7-28KRGKAGKVEKRKTKKDPNAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTKRGKAGKVEKRKTKKDPNAPKRGLSAYMFFANEQRENVRDENPGISFGQVGKILGERWKALNDKQRTPYEAKAAADKKRYEDEKQAYQAEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.85
4 0.88
5 0.88
6 0.89
7 0.89
8 0.88
9 0.9
10 0.9
11 0.91
12 0.85
13 0.77
14 0.7
15 0.62
16 0.54
17 0.44
18 0.36
19 0.28
20 0.26
21 0.24
22 0.2
23 0.2
24 0.19
25 0.18
26 0.17
27 0.15
28 0.14
29 0.17
30 0.18
31 0.18
32 0.16
33 0.16
34 0.17
35 0.15
36 0.16
37 0.13
38 0.11
39 0.09
40 0.08
41 0.09
42 0.08
43 0.07
44 0.06
45 0.07
46 0.08
47 0.1
48 0.12
49 0.11
50 0.12
51 0.16
52 0.19
53 0.24
54 0.32
55 0.35
56 0.41
57 0.47
58 0.5
59 0.51
60 0.53
61 0.51
62 0.49
63 0.47
64 0.41
65 0.43
66 0.45
67 0.47
68 0.5
69 0.47
70 0.45
71 0.5
72 0.53
73 0.5
74 0.54
75 0.55
76 0.57
77 0.61
78 0.6