Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EM31

Protein Details
Accession H0EM31    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
164-183LLGKAPSNLKKYRQRRRGNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, pero 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR012132  GMC_OxRdtase  
IPR000172  GMC_OxRdtase_N  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016614  F:oxidoreductase activity, acting on CH-OH group of donors  
Pfam View protein in Pfam  
PF00732  GMC_oxred_N  
PROSITE View protein in PROSITE  
PS00624  GMC_OXRED_2  
Amino Acid Sequences MFDRGSADDYDNWEKLQNPEFGYTYDESAYGGHGPIYASYPPFQWPQQTNQEVIIAAGSFGSPALLQRSGIGPKGLLKKAGIDVKLDLPGVGQNLQDHAASVRFNHAACTRYTFGCYCLCGCREDEPDDVFVLPMDDGQLEHQEDNHVRCLKILAAPLELIEPLLGKAPSNLKKYRQRRRGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.32
4 0.3
5 0.27
6 0.3
7 0.31
8 0.3
9 0.31
10 0.28
11 0.24
12 0.2
13 0.18
14 0.14
15 0.13
16 0.14
17 0.1
18 0.09
19 0.07
20 0.07
21 0.08
22 0.08
23 0.11
24 0.11
25 0.11
26 0.12
27 0.13
28 0.15
29 0.18
30 0.18
31 0.23
32 0.24
33 0.3
34 0.38
35 0.39
36 0.38
37 0.36
38 0.36
39 0.28
40 0.25
41 0.19
42 0.09
43 0.07
44 0.06
45 0.05
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.06
52 0.07
53 0.07
54 0.08
55 0.11
56 0.12
57 0.13
58 0.12
59 0.1
60 0.15
61 0.21
62 0.21
63 0.2
64 0.19
65 0.19
66 0.23
67 0.27
68 0.22
69 0.17
70 0.17
71 0.17
72 0.18
73 0.16
74 0.12
75 0.08
76 0.09
77 0.08
78 0.08
79 0.07
80 0.06
81 0.07
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.09
90 0.09
91 0.09
92 0.12
93 0.14
94 0.14
95 0.14
96 0.2
97 0.19
98 0.18
99 0.21
100 0.19
101 0.19
102 0.19
103 0.19
104 0.15
105 0.17
106 0.17
107 0.17
108 0.18
109 0.2
110 0.23
111 0.25
112 0.25
113 0.23
114 0.24
115 0.23
116 0.21
117 0.16
118 0.12
119 0.1
120 0.07
121 0.06
122 0.05
123 0.05
124 0.05
125 0.06
126 0.09
127 0.1
128 0.1
129 0.11
130 0.15
131 0.18
132 0.2
133 0.26
134 0.26
135 0.25
136 0.25
137 0.26
138 0.23
139 0.24
140 0.26
141 0.2
142 0.19
143 0.19
144 0.18
145 0.18
146 0.16
147 0.12
148 0.08
149 0.07
150 0.06
151 0.09
152 0.09
153 0.09
154 0.13
155 0.22
156 0.29
157 0.36
158 0.42
159 0.47
160 0.58
161 0.69
162 0.77
163 0.78