Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EJW1

Protein Details
Accession H0EJW1   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-45IHPNITPNKPPNPRRRRQRPRDGFEAVHydrophilic
NLS Segment(s)
PositionSequence
27-38KPPNPRRRRQRP
Subcellular Location(s) nucl 15.5, mito_nucl 12.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011006  CheY-like_superfamily  
IPR001789  Sig_transdc_resp-reg_receiver  
Gene Ontology GO:0016301  F:kinase activity  
GO:0000160  P:phosphorelay signal transduction system  
GO:0016310  P:phosphorylation  
PROSITE View protein in PROSITE  
PS50110  RESPONSE_REGULATORY  
Amino Acid Sequences MRLNATNSTAIRPSSRTLIHPNITPNKPPNPRRRRQRPRDGFEAVNAYKTALTNPNPALKTFDVVFMDISMPGMDGFEATRVIRKLEAEREKSEQEKVRRALRFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.29
4 0.34
5 0.4
6 0.4
7 0.41
8 0.46
9 0.49
10 0.5
11 0.51
12 0.49
13 0.51
14 0.58
15 0.64
16 0.67
17 0.69
18 0.75
19 0.81
20 0.87
21 0.89
22 0.9
23 0.92
24 0.92
25 0.88
26 0.86
27 0.79
28 0.68
29 0.59
30 0.55
31 0.43
32 0.34
33 0.27
34 0.2
35 0.16
36 0.15
37 0.15
38 0.12
39 0.14
40 0.16
41 0.17
42 0.23
43 0.23
44 0.23
45 0.25
46 0.21
47 0.21
48 0.18
49 0.2
50 0.15
51 0.15
52 0.14
53 0.11
54 0.11
55 0.09
56 0.09
57 0.06
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.06
67 0.11
68 0.11
69 0.13
70 0.14
71 0.17
72 0.21
73 0.3
74 0.39
75 0.41
76 0.44
77 0.48
78 0.52
79 0.52
80 0.54
81 0.53
82 0.51
83 0.55
84 0.57
85 0.6