Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EE84

Protein Details
Accession A0A1Y2EE84    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VSAKKHVPIVKKRTKTFNRHQSDRFKCLDRSWRKPKGIDNRVRRRFRGHydrophilic
NLS Segment(s)
PositionSequence
34-46RKPKGIDNRVRRR
Subcellular Location(s) mito 20, mito_nucl 14.333, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKTFNRHQSDRFKCLDRSWRKPKGIDNRVRRRFRGSMVMPSIGFGSNKKTRHMMPSGHKAFLVSNTQDVELLLMHNRTYAAEIAHNVSSRKRIDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.83
4 0.84
5 0.84
6 0.83
7 0.81
8 0.83
9 0.83
10 0.81
11 0.77
12 0.71
13 0.65
14 0.58
15 0.57
16 0.6
17 0.58
18 0.61
19 0.65
20 0.69
21 0.69
22 0.7
23 0.73
24 0.73
25 0.74
26 0.74
27 0.75
28 0.76
29 0.82
30 0.83
31 0.76
32 0.72
33 0.64
34 0.58
35 0.56
36 0.48
37 0.46
38 0.43
39 0.43
40 0.35
41 0.32
42 0.3
43 0.21
44 0.18
45 0.11
46 0.14
47 0.19
48 0.2
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.39
60 0.35
61 0.31
62 0.27
63 0.25
64 0.15
65 0.14
66 0.14
67 0.15
68 0.14
69 0.13
70 0.11
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.08
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47