Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EJ29

Protein Details
Accession A0A1Y2EJ29    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-50NDAPKPSKSSSRKQRKPCKKLTRTSVPYPHydrophilic
NLS Segment(s)
PositionSequence
32-37SRKQRK
Subcellular Location(s) nucl 12, cyto_nucl 10.5, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MCTETTYTLRCEHVTTRTAYCNDAPKPSKSSSRKQRKPCKKLTRTSVPYPPPPEFGQHVKCPLTPCPFEERGGYWNCCWCGKEWNDTGRCRCVMIIDRQEYRCEHICCETCEQAVEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.32
4 0.36
5 0.36
6 0.35
7 0.35
8 0.37
9 0.36
10 0.41
11 0.41
12 0.39
13 0.43
14 0.44
15 0.51
16 0.49
17 0.57
18 0.59
19 0.67
20 0.73
21 0.78
22 0.86
23 0.87
24 0.9
25 0.91
26 0.91
27 0.89
28 0.89
29 0.87
30 0.87
31 0.82
32 0.79
33 0.76
34 0.7
35 0.66
36 0.62
37 0.54
38 0.46
39 0.4
40 0.36
41 0.31
42 0.32
43 0.3
44 0.27
45 0.3
46 0.27
47 0.28
48 0.28
49 0.29
50 0.29
51 0.25
52 0.26
53 0.29
54 0.3
55 0.29
56 0.28
57 0.25
58 0.25
59 0.28
60 0.28
61 0.22
62 0.24
63 0.25
64 0.25
65 0.24
66 0.21
67 0.25
68 0.26
69 0.32
70 0.33
71 0.4
72 0.45
73 0.5
74 0.53
75 0.49
76 0.47
77 0.41
78 0.35
79 0.32
80 0.32
81 0.36
82 0.41
83 0.41
84 0.47
85 0.47
86 0.51
87 0.47
88 0.47
89 0.45
90 0.38
91 0.35
92 0.38
93 0.41
94 0.42
95 0.47
96 0.44
97 0.36