Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DQ71

Protein Details
Accession A0A1Y2DQ71    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
519-543ITPSLVTRQDRKRMRQLQPKTPTLEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, nucl 3, plas 3, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQPGLYSAAVSPQSVVILTSSAFITLCHSAPATPKRNNNPLGIDWDPAPAPEDGPPGAAGALRDPAYLPAQIGGIVGSYALSLVIVATLLLILAKKRREHIEAGELDLNEYVYDYECGFESGFEPNEHFPYPLALPKSPIKNFSHPTPIEAPTPVDNEDLNPYIYPSSPQSAVALGINPLVDQNVVAADREMAQQQLEEMYKYVMEQEEAKQAGVILEEPPAPILKQADHSVSSLQRPPEVAQRSGGILRKGRNKPAGLDLAKPEQPEKTQSRTSTFFSALKSPRKKPVKGISISSPIMTPMSGTFPRYEGEEMETIPPRHYAPAPPPPVPADQDPYARRTTRNLAPITPPDFSPESTMSIDERLEAQLGQRSHSRNPSQAPTEPDPASAISEKSTTPLVGLPSSPKPGVTRFPTLPSSPKPGASFSRNTPPLSPGLPTPKPGSTFTRANAPSAVRTGGALPLRAYEPSLASPSMQTTKQTTFERADRAPLSPGGLRTPWTGAPVPYSPYQPYTPVVPITPSLVTRQDRKRMRQLQPKTPTLEMVKSSDDIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.08
4 0.08
5 0.08
6 0.09
7 0.08
8 0.08
9 0.08
10 0.08
11 0.11
12 0.13
13 0.14
14 0.14
15 0.14
16 0.15
17 0.24
18 0.34
19 0.39
20 0.43
21 0.52
22 0.6
23 0.69
24 0.72
25 0.68
26 0.64
27 0.58
28 0.58
29 0.51
30 0.44
31 0.35
32 0.33
33 0.28
34 0.22
35 0.22
36 0.14
37 0.14
38 0.14
39 0.16
40 0.14
41 0.15
42 0.15
43 0.13
44 0.13
45 0.13
46 0.11
47 0.09
48 0.13
49 0.12
50 0.12
51 0.12
52 0.15
53 0.16
54 0.16
55 0.15
56 0.12
57 0.11
58 0.11
59 0.11
60 0.08
61 0.06
62 0.06
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.06
80 0.12
81 0.17
82 0.2
83 0.25
84 0.31
85 0.35
86 0.39
87 0.42
88 0.46
89 0.42
90 0.45
91 0.43
92 0.38
93 0.34
94 0.29
95 0.24
96 0.14
97 0.13
98 0.09
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.09
105 0.08
106 0.08
107 0.08
108 0.11
109 0.13
110 0.13
111 0.15
112 0.16
113 0.19
114 0.19
115 0.18
116 0.15
117 0.16
118 0.17
119 0.2
120 0.22
121 0.19
122 0.23
123 0.28
124 0.36
125 0.36
126 0.41
127 0.41
128 0.46
129 0.49
130 0.5
131 0.54
132 0.45
133 0.48
134 0.46
135 0.43
136 0.37
137 0.34
138 0.31
139 0.24
140 0.26
141 0.22
142 0.18
143 0.16
144 0.15
145 0.17
146 0.17
147 0.15
148 0.13
149 0.12
150 0.12
151 0.12
152 0.13
153 0.12
154 0.13
155 0.13
156 0.14
157 0.14
158 0.13
159 0.14
160 0.13
161 0.11
162 0.08
163 0.08
164 0.08
165 0.07
166 0.06
167 0.06
168 0.05
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.06
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.07
183 0.09
184 0.09
185 0.08
186 0.08
187 0.08
188 0.08
189 0.08
190 0.09
191 0.07
192 0.07
193 0.09
194 0.1
195 0.15
196 0.16
197 0.15
198 0.14
199 0.14
200 0.13
201 0.11
202 0.1
203 0.05
204 0.06
205 0.07
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.08
212 0.07
213 0.1
214 0.12
215 0.13
216 0.14
217 0.15
218 0.16
219 0.17
220 0.19
221 0.2
222 0.18
223 0.17
224 0.17
225 0.18
226 0.23
227 0.25
228 0.23
229 0.21
230 0.21
231 0.22
232 0.24
233 0.25
234 0.2
235 0.2
236 0.24
237 0.33
238 0.36
239 0.4
240 0.42
241 0.41
242 0.39
243 0.41
244 0.44
245 0.36
246 0.34
247 0.31
248 0.29
249 0.29
250 0.28
251 0.24
252 0.17
253 0.17
254 0.21
255 0.23
256 0.25
257 0.28
258 0.29
259 0.33
260 0.34
261 0.35
262 0.31
263 0.3
264 0.26
265 0.23
266 0.28
267 0.29
268 0.36
269 0.4
270 0.4
271 0.48
272 0.53
273 0.54
274 0.56
275 0.6
276 0.6
277 0.56
278 0.56
279 0.51
280 0.49
281 0.48
282 0.39
283 0.3
284 0.21
285 0.19
286 0.15
287 0.11
288 0.06
289 0.1
290 0.1
291 0.11
292 0.11
293 0.12
294 0.12
295 0.13
296 0.13
297 0.1
298 0.12
299 0.12
300 0.12
301 0.14
302 0.17
303 0.16
304 0.16
305 0.16
306 0.14
307 0.15
308 0.16
309 0.16
310 0.19
311 0.28
312 0.32
313 0.32
314 0.33
315 0.33
316 0.34
317 0.33
318 0.29
319 0.24
320 0.22
321 0.27
322 0.27
323 0.28
324 0.3
325 0.29
326 0.28
327 0.28
328 0.32
329 0.31
330 0.37
331 0.36
332 0.34
333 0.37
334 0.41
335 0.4
336 0.35
337 0.29
338 0.26
339 0.25
340 0.23
341 0.23
342 0.19
343 0.19
344 0.18
345 0.19
346 0.16
347 0.16
348 0.15
349 0.12
350 0.11
351 0.09
352 0.09
353 0.08
354 0.09
355 0.12
356 0.13
357 0.14
358 0.18
359 0.21
360 0.24
361 0.33
362 0.35
363 0.35
364 0.39
365 0.43
366 0.43
367 0.44
368 0.47
369 0.43
370 0.46
371 0.41
372 0.37
373 0.32
374 0.28
375 0.26
376 0.2
377 0.16
378 0.12
379 0.13
380 0.12
381 0.12
382 0.13
383 0.1
384 0.1
385 0.11
386 0.12
387 0.12
388 0.13
389 0.16
390 0.18
391 0.21
392 0.21
393 0.2
394 0.2
395 0.23
396 0.29
397 0.3
398 0.34
399 0.32
400 0.37
401 0.39
402 0.4
403 0.42
404 0.39
405 0.42
406 0.37
407 0.38
408 0.35
409 0.36
410 0.39
411 0.39
412 0.39
413 0.36
414 0.44
415 0.45
416 0.45
417 0.42
418 0.39
419 0.36
420 0.33
421 0.3
422 0.25
423 0.3
424 0.3
425 0.31
426 0.33
427 0.33
428 0.35
429 0.37
430 0.39
431 0.36
432 0.39
433 0.37
434 0.43
435 0.41
436 0.39
437 0.39
438 0.34
439 0.3
440 0.28
441 0.28
442 0.18
443 0.18
444 0.17
445 0.18
446 0.18
447 0.17
448 0.15
449 0.16
450 0.17
451 0.17
452 0.17
453 0.13
454 0.14
455 0.15
456 0.17
457 0.16
458 0.15
459 0.16
460 0.19
461 0.22
462 0.21
463 0.21
464 0.24
465 0.27
466 0.33
467 0.36
468 0.36
469 0.38
470 0.42
471 0.46
472 0.42
473 0.45
474 0.4
475 0.39
476 0.37
477 0.33
478 0.31
479 0.28
480 0.28
481 0.25
482 0.25
483 0.25
484 0.24
485 0.26
486 0.24
487 0.25
488 0.26
489 0.23
490 0.26
491 0.27
492 0.28
493 0.27
494 0.3
495 0.28
496 0.3
497 0.31
498 0.29
499 0.29
500 0.29
501 0.3
502 0.29
503 0.27
504 0.25
505 0.24
506 0.24
507 0.25
508 0.21
509 0.22
510 0.28
511 0.31
512 0.38
513 0.46
514 0.53
515 0.6
516 0.67
517 0.75
518 0.77
519 0.84
520 0.85
521 0.86
522 0.87
523 0.87
524 0.85
525 0.8
526 0.71
527 0.67
528 0.61
529 0.57
530 0.5
531 0.44
532 0.4