Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EDL2

Protein Details
Accession A0A1Y2EDL2    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-41ESAAQTAKSRCRKSPNSHCSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 8, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024461  CCDC90-like  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF07798  CCDC90-like  
Amino Acid Sequences MPAQRLTFLYPHLYRSLRLGESAAQTAKSRCRKSPNSHCSGHYAVAFSTSARRRKAVFERHGKAVEPQPASPNVVKLPQPGKEMRGSKGGPKDENHGTPEFKAKDDFELDSKKAVEESPETEESPKTEKPTPPSEGSGSAQQARPTPQQVAAEEKMQSSGPMEAVLHMPPPSQFSHPHISTPPYIHHFDTYGLVKQLEGGGYTEEQAITVMKAVRTLLAQNLGMAQTGLVSKSDVDNETYLFRAACSELSTEVDNNRKAADEQMRQQRTLLQHEVDILGQRLSQDLMTLKDDVKGMFNDRRMAVREEQRRTESAIQQVNLEISVTLNSDAKSEIEGLRWVLIRRSVLGILFMVVLTLGTIRYTTYIGHEQQKELEEQRRQEEEKRRNNGRVDHAPAPDAAEILAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.39
4 0.32
5 0.31
6 0.3
7 0.28
8 0.3
9 0.34
10 0.3
11 0.25
12 0.27
13 0.31
14 0.38
15 0.43
16 0.45
17 0.48
18 0.57
19 0.65
20 0.73
21 0.8
22 0.81
23 0.79
24 0.78
25 0.73
26 0.69
27 0.63
28 0.55
29 0.45
30 0.37
31 0.29
32 0.27
33 0.24
34 0.18
35 0.23
36 0.28
37 0.33
38 0.34
39 0.37
40 0.37
41 0.46
42 0.55
43 0.58
44 0.6
45 0.64
46 0.67
47 0.7
48 0.7
49 0.62
50 0.57
51 0.53
52 0.51
53 0.43
54 0.4
55 0.37
56 0.38
57 0.41
58 0.37
59 0.32
60 0.27
61 0.28
62 0.28
63 0.3
64 0.33
65 0.33
66 0.38
67 0.37
68 0.39
69 0.43
70 0.45
71 0.4
72 0.43
73 0.4
74 0.42
75 0.47
76 0.49
77 0.45
78 0.44
79 0.47
80 0.45
81 0.47
82 0.45
83 0.4
84 0.36
85 0.33
86 0.4
87 0.35
88 0.3
89 0.29
90 0.26
91 0.26
92 0.27
93 0.27
94 0.24
95 0.28
96 0.27
97 0.27
98 0.27
99 0.23
100 0.21
101 0.2
102 0.18
103 0.15
104 0.18
105 0.21
106 0.22
107 0.22
108 0.23
109 0.23
110 0.22
111 0.25
112 0.24
113 0.23
114 0.27
115 0.3
116 0.35
117 0.41
118 0.44
119 0.42
120 0.43
121 0.4
122 0.37
123 0.35
124 0.33
125 0.29
126 0.27
127 0.26
128 0.24
129 0.25
130 0.26
131 0.27
132 0.25
133 0.25
134 0.25
135 0.26
136 0.25
137 0.3
138 0.26
139 0.26
140 0.24
141 0.22
142 0.2
143 0.17
144 0.16
145 0.1
146 0.1
147 0.07
148 0.07
149 0.07
150 0.07
151 0.08
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.1
158 0.11
159 0.13
160 0.15
161 0.18
162 0.26
163 0.26
164 0.28
165 0.27
166 0.28
167 0.27
168 0.27
169 0.25
170 0.21
171 0.23
172 0.22
173 0.21
174 0.19
175 0.18
176 0.18
177 0.17
178 0.14
179 0.13
180 0.12
181 0.11
182 0.11
183 0.11
184 0.08
185 0.07
186 0.06
187 0.06
188 0.06
189 0.07
190 0.06
191 0.06
192 0.05
193 0.05
194 0.05
195 0.04
196 0.06
197 0.06
198 0.06
199 0.07
200 0.07
201 0.07
202 0.08
203 0.08
204 0.08
205 0.09
206 0.09
207 0.08
208 0.09
209 0.09
210 0.08
211 0.07
212 0.06
213 0.04
214 0.05
215 0.05
216 0.04
217 0.04
218 0.05
219 0.06
220 0.08
221 0.08
222 0.09
223 0.09
224 0.1
225 0.11
226 0.11
227 0.1
228 0.09
229 0.08
230 0.08
231 0.08
232 0.07
233 0.08
234 0.08
235 0.08
236 0.1
237 0.11
238 0.11
239 0.13
240 0.18
241 0.18
242 0.18
243 0.17
244 0.17
245 0.16
246 0.22
247 0.26
248 0.25
249 0.32
250 0.42
251 0.44
252 0.44
253 0.44
254 0.42
255 0.38
256 0.4
257 0.36
258 0.27
259 0.25
260 0.26
261 0.26
262 0.22
263 0.19
264 0.13
265 0.1
266 0.09
267 0.09
268 0.08
269 0.08
270 0.07
271 0.08
272 0.08
273 0.1
274 0.12
275 0.13
276 0.13
277 0.15
278 0.16
279 0.15
280 0.16
281 0.15
282 0.19
283 0.22
284 0.24
285 0.26
286 0.26
287 0.29
288 0.3
289 0.34
290 0.35
291 0.39
292 0.46
293 0.48
294 0.53
295 0.53
296 0.5
297 0.52
298 0.51
299 0.47
300 0.46
301 0.45
302 0.4
303 0.38
304 0.37
305 0.32
306 0.25
307 0.2
308 0.12
309 0.07
310 0.07
311 0.08
312 0.08
313 0.09
314 0.09
315 0.1
316 0.11
317 0.11
318 0.11
319 0.13
320 0.12
321 0.12
322 0.14
323 0.14
324 0.16
325 0.18
326 0.18
327 0.18
328 0.21
329 0.2
330 0.2
331 0.22
332 0.21
333 0.19
334 0.19
335 0.16
336 0.14
337 0.13
338 0.11
339 0.08
340 0.06
341 0.06
342 0.04
343 0.04
344 0.04
345 0.04
346 0.04
347 0.05
348 0.06
349 0.07
350 0.08
351 0.13
352 0.2
353 0.25
354 0.34
355 0.36
356 0.36
357 0.4
358 0.41
359 0.41
360 0.4
361 0.44
362 0.42
363 0.44
364 0.5
365 0.53
366 0.54
367 0.59
368 0.63
369 0.65
370 0.69
371 0.74
372 0.75
373 0.76
374 0.79
375 0.78
376 0.77
377 0.76
378 0.73
379 0.69
380 0.63
381 0.57
382 0.5
383 0.45
384 0.36
385 0.27
386 0.19