Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EKB6

Protein Details
Accession A0A1Y2EKB6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-55QNRIAQRKFREKNKEHREKSBasic
NLS Segment(s)
PositionSequence
37-53NRIAQRKFREKNKEHRE
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences SSSKKHSSSSSKSSKSKTKPDDWTDITEPEERRRIQNRIAQRKFREKNKEHREKSERDIHNQEHAGRTYHVPEPQEITDDGGNVSGLPWGGVNMRYVVARGHENESRRGSGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.77
4 0.75
5 0.74
6 0.75
7 0.75
8 0.76
9 0.7
10 0.68
11 0.61
12 0.54
13 0.47
14 0.43
15 0.39
16 0.35
17 0.38
18 0.32
19 0.37
20 0.41
21 0.43
22 0.44
23 0.49
24 0.55
25 0.59
26 0.66
27 0.67
28 0.67
29 0.73
30 0.73
31 0.76
32 0.76
33 0.71
34 0.75
35 0.78
36 0.82
37 0.75
38 0.78
39 0.75
40 0.69
41 0.68
42 0.67
43 0.58
44 0.52
45 0.55
46 0.46
47 0.45
48 0.42
49 0.38
50 0.31
51 0.3
52 0.25
53 0.21
54 0.2
55 0.19
56 0.2
57 0.21
58 0.19
59 0.19
60 0.21
61 0.2
62 0.21
63 0.18
64 0.17
65 0.15
66 0.14
67 0.13
68 0.1
69 0.09
70 0.07
71 0.07
72 0.05
73 0.05
74 0.05
75 0.04
76 0.05
77 0.07
78 0.08
79 0.08
80 0.09
81 0.1
82 0.1
83 0.1
84 0.11
85 0.12
86 0.15
87 0.18
88 0.22
89 0.26
90 0.29
91 0.36
92 0.39
93 0.41