Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DQV9

Protein Details
Accession A0A1Y2DQV9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
198-221GLSHTLKKDKSNGKKKRKAEEGANBasic
NLS Segment(s)
PositionSequence
202-217TLKKDKSNGKKKRKAE
262-275KSKRRKIAEGHKRS
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIPKRRELVKEAARLPSASELKEAAAENLNHSWSFCPLSSSAIDPTNTVSDWRGRLYNYESILQWLLPSPETSIPETQEEAFKSTGIRNLKDVLKLKFTIRKDEKGREFRACPISLKELGAATKALYIVPCGHVFAEVAMKEIFDSEGTEAEHRCPECSEVFETENVIPILPSSESEIARLASRLESLKARGLSHTLKKDKSNGKKKRKAEEGANGDIQNSNKKEKKDKESGIESRINNASTASLTAKVLAEQEEKSKRRKIAEGHKRSEAVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.56
4 0.55
5 0.57
6 0.56
7 0.5
8 0.45
9 0.43
10 0.38
11 0.3
12 0.28
13 0.23
14 0.22
15 0.25
16 0.24
17 0.17
18 0.2
19 0.19
20 0.21
21 0.22
22 0.23
23 0.2
24 0.2
25 0.19
26 0.16
27 0.19
28 0.16
29 0.16
30 0.15
31 0.18
32 0.19
33 0.2
34 0.21
35 0.21
36 0.21
37 0.19
38 0.2
39 0.19
40 0.18
41 0.17
42 0.16
43 0.17
44 0.19
45 0.21
46 0.2
47 0.19
48 0.23
49 0.26
50 0.3
51 0.27
52 0.28
53 0.25
54 0.26
55 0.26
56 0.22
57 0.17
58 0.14
59 0.13
60 0.11
61 0.11
62 0.11
63 0.14
64 0.16
65 0.18
66 0.19
67 0.19
68 0.2
69 0.21
70 0.19
71 0.19
72 0.18
73 0.18
74 0.17
75 0.15
76 0.15
77 0.15
78 0.2
79 0.2
80 0.2
81 0.19
82 0.23
83 0.25
84 0.3
85 0.34
86 0.31
87 0.31
88 0.32
89 0.33
90 0.36
91 0.35
92 0.4
93 0.4
94 0.46
95 0.48
96 0.55
97 0.61
98 0.62
99 0.65
100 0.6
101 0.57
102 0.54
103 0.54
104 0.46
105 0.39
106 0.33
107 0.32
108 0.28
109 0.26
110 0.21
111 0.16
112 0.15
113 0.14
114 0.11
115 0.08
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.07
129 0.09
130 0.07
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.07
137 0.05
138 0.06
139 0.04
140 0.06
141 0.06
142 0.08
143 0.08
144 0.09
145 0.12
146 0.12
147 0.12
148 0.11
149 0.13
150 0.13
151 0.15
152 0.15
153 0.15
154 0.16
155 0.15
156 0.17
157 0.14
158 0.16
159 0.14
160 0.11
161 0.09
162 0.08
163 0.09
164 0.07
165 0.07
166 0.08
167 0.11
168 0.12
169 0.13
170 0.13
171 0.13
172 0.13
173 0.13
174 0.11
175 0.08
176 0.1
177 0.1
178 0.11
179 0.13
180 0.14
181 0.19
182 0.2
183 0.21
184 0.2
185 0.24
186 0.28
187 0.33
188 0.41
189 0.42
190 0.44
191 0.46
192 0.54
193 0.6
194 0.64
195 0.68
196 0.69
197 0.75
198 0.8
199 0.85
200 0.87
201 0.86
202 0.82
203 0.8
204 0.79
205 0.75
206 0.7
207 0.66
208 0.56
209 0.47
210 0.43
211 0.36
212 0.33
213 0.29
214 0.33
215 0.33
216 0.39
217 0.48
218 0.55
219 0.63
220 0.65
221 0.69
222 0.69
223 0.74
224 0.74
225 0.71
226 0.69
227 0.6
228 0.55
229 0.52
230 0.44
231 0.34
232 0.29
233 0.24
234 0.17
235 0.19
236 0.15
237 0.14
238 0.13
239 0.15
240 0.14
241 0.14
242 0.15
243 0.16
244 0.17
245 0.17
246 0.26
247 0.34
248 0.38
249 0.44
250 0.5
251 0.52
252 0.55
253 0.61
254 0.62
255 0.64
256 0.71
257 0.76
258 0.74
259 0.76