Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E7F5

Protein Details
Accession A0A1Y2E7F5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
136-164GGVKRFPVQAPRQKRRPHREAKAQEEQHQHydrophilic
NLS Segment(s)
PositionSequence
147-154RQKRRPHR
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MAKQKGSGSVQNRPIYSRLSYLYQAAAHLGSASNDQKIDATTKQALEDGAHSTASQTQKSESHVKQAMARNLLKELRAISHKTQIRISPAIKHTICKSCDTLLVEGDTCTSTVENKSKGGKKPWADVLVVKCKTCGGVKRFPVQAPRQKRRPHREAKAQEEQHQTMVQGENLEAMVQDKQPRAMVQGEQTQAMDTNDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.4
4 0.35
5 0.29
6 0.28
7 0.29
8 0.27
9 0.28
10 0.24
11 0.22
12 0.19
13 0.16
14 0.12
15 0.11
16 0.1
17 0.08
18 0.12
19 0.13
20 0.13
21 0.13
22 0.14
23 0.14
24 0.15
25 0.18
26 0.14
27 0.18
28 0.2
29 0.2
30 0.21
31 0.21
32 0.2
33 0.17
34 0.17
35 0.15
36 0.13
37 0.12
38 0.11
39 0.11
40 0.16
41 0.18
42 0.17
43 0.15
44 0.17
45 0.18
46 0.23
47 0.31
48 0.27
49 0.32
50 0.35
51 0.35
52 0.4
53 0.44
54 0.44
55 0.41
56 0.42
57 0.35
58 0.35
59 0.35
60 0.28
61 0.23
62 0.19
63 0.16
64 0.18
65 0.21
66 0.2
67 0.27
68 0.29
69 0.3
70 0.32
71 0.31
72 0.32
73 0.33
74 0.32
75 0.3
76 0.29
77 0.34
78 0.32
79 0.31
80 0.31
81 0.33
82 0.34
83 0.29
84 0.29
85 0.23
86 0.25
87 0.25
88 0.22
89 0.16
90 0.15
91 0.13
92 0.11
93 0.11
94 0.08
95 0.06
96 0.06
97 0.05
98 0.06
99 0.09
100 0.13
101 0.14
102 0.16
103 0.23
104 0.29
105 0.34
106 0.39
107 0.43
108 0.42
109 0.46
110 0.49
111 0.45
112 0.4
113 0.39
114 0.39
115 0.41
116 0.4
117 0.35
118 0.29
119 0.27
120 0.27
121 0.27
122 0.29
123 0.26
124 0.33
125 0.37
126 0.43
127 0.46
128 0.47
129 0.52
130 0.53
131 0.56
132 0.59
133 0.64
134 0.67
135 0.72
136 0.81
137 0.83
138 0.84
139 0.85
140 0.84
141 0.86
142 0.87
143 0.87
144 0.86
145 0.8
146 0.78
147 0.75
148 0.66
149 0.58
150 0.49
151 0.4
152 0.33
153 0.3
154 0.23
155 0.16
156 0.15
157 0.13
158 0.12
159 0.12
160 0.08
161 0.08
162 0.09
163 0.11
164 0.16
165 0.17
166 0.19
167 0.21
168 0.22
169 0.24
170 0.25
171 0.26
172 0.27
173 0.33
174 0.32
175 0.32
176 0.31
177 0.29
178 0.27