Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DFJ6

Protein Details
Accession A0A1Y2DFJ6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
102-123ARKGIKPKTREQKHMKSQKFNEBasic
NLS Segment(s)
PositionSequence
102-113ARKGIKPKTREQ
157-169KVGKDPKQKKRRT
Subcellular Location(s) cyto 9.5, cyto_mito 8.5, nucl 7, mito 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MAPEKLDISVDKPTPYTYDLGLLLATDANPLPSPESGSLEERLAATARDGAQALINQMMMTLPIQSTSAGVLMTLPAPETPLPREKPLPAAKEQTKWQAFAARKGIKPKTREQKHMKSQKFNEDTGAWEKTWGYKGKRPEGEVPADWVVEVDEKGEKVGKDPKQKKRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.18
5 0.19
6 0.18
7 0.17
8 0.16
9 0.13
10 0.11
11 0.09
12 0.09
13 0.07
14 0.06
15 0.07
16 0.08
17 0.08
18 0.1
19 0.1
20 0.13
21 0.13
22 0.17
23 0.18
24 0.2
25 0.21
26 0.2
27 0.2
28 0.17
29 0.16
30 0.13
31 0.11
32 0.09
33 0.1
34 0.1
35 0.11
36 0.11
37 0.1
38 0.11
39 0.11
40 0.11
41 0.09
42 0.08
43 0.07
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.05
65 0.06
66 0.07
67 0.09
68 0.15
69 0.17
70 0.19
71 0.21
72 0.2
73 0.28
74 0.32
75 0.33
76 0.3
77 0.36
78 0.36
79 0.38
80 0.4
81 0.41
82 0.37
83 0.34
84 0.32
85 0.31
86 0.3
87 0.32
88 0.38
89 0.34
90 0.36
91 0.43
92 0.49
93 0.48
94 0.52
95 0.56
96 0.58
97 0.6
98 0.68
99 0.7
100 0.73
101 0.78
102 0.84
103 0.81
104 0.8
105 0.78
106 0.79
107 0.73
108 0.63
109 0.56
110 0.47
111 0.43
112 0.38
113 0.35
114 0.24
115 0.21
116 0.21
117 0.21
118 0.26
119 0.28
120 0.3
121 0.33
122 0.41
123 0.5
124 0.55
125 0.56
126 0.58
127 0.58
128 0.58
129 0.54
130 0.5
131 0.42
132 0.37
133 0.32
134 0.24
135 0.19
136 0.14
137 0.13
138 0.09
139 0.1
140 0.1
141 0.11
142 0.15
143 0.14
144 0.18
145 0.27
146 0.34
147 0.43
148 0.53
149 0.63