Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DA46

Protein Details
Accession A0A1Y2DA46    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-69IHYATMKPEQKKKKEEKKPPAKKBasic
NLS Segment(s)
PositionSequence
55-69EQKKKKEEKKPPAKK
Subcellular Location(s) cyto 10.5, cyto_nucl 6.5, mito 6, E.R. 6, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFSKIGATPQAVAVLNDQPYLFTILLVVLVSLILESVLIWYIHYATMKPEQKKKKEEKKPPAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.18
4 0.17
5 0.17
6 0.16
7 0.15
8 0.15
9 0.14
10 0.11
11 0.11
12 0.14
13 0.12
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.04
33 0.05
34 0.06
35 0.07
36 0.07
37 0.09
38 0.19
39 0.26
40 0.33
41 0.42
42 0.51
43 0.6
44 0.7
45 0.78
46 0.8
47 0.84
48 0.88
49 0.9