Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E9Q2

Protein Details
Accession A0A1Y2E9Q2    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRKNNGRNKKGRGHVKPIRCSNCSHydrophilic
82-106KIVRVRSRVGRRNRAPPPRVRYNKDBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
85-108RVRSRVGRRNRAPPPRVRYNKDGK
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSRVGRRNRAPPPRVRYNKDGKKVVPTQQTAKPLGAAGGATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.86
4 0.83
5 0.82
6 0.83
7 0.83
8 0.8
9 0.73
10 0.72
11 0.7
12 0.7
13 0.69
14 0.66
15 0.64
16 0.65
17 0.68
18 0.7
19 0.72
20 0.71
21 0.73
22 0.73
23 0.75
24 0.72
25 0.73
26 0.68
27 0.68
28 0.6
29 0.53
30 0.46
31 0.37
32 0.35
33 0.27
34 0.25
35 0.16
36 0.15
37 0.12
38 0.1
39 0.1
40 0.08
41 0.08
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.1
55 0.16
56 0.18
57 0.19
58 0.22
59 0.23
60 0.24
61 0.26
62 0.23
63 0.18
64 0.18
65 0.17
66 0.18
67 0.18
68 0.2
69 0.2
70 0.26
71 0.29
72 0.29
73 0.31
74 0.36
75 0.45
76 0.51
77 0.57
78 0.62
79 0.63
80 0.72
81 0.79
82 0.8
83 0.77
84 0.78
85 0.77
86 0.77
87 0.8
88 0.76
89 0.75
90 0.76
91 0.79
92 0.78
93 0.77
94 0.68
95 0.68
96 0.69
97 0.68
98 0.66
99 0.61
100 0.59
101 0.58
102 0.62
103 0.55
104 0.49
105 0.42
106 0.33
107 0.29
108 0.23