Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DP11

Protein Details
Accession A0A1Y2DP11    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-31RHIRHVQRSRPRKLAQRHNFRHVRBasic
NLS Segment(s)
PositionSequence
19-19R
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTGDFAQRHIRHVQRSRPRKLAQRHNFRHVRGSGIGRTPAGDPRHLAPLANEKPEHRLESNPDHPLSDRIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.73
3 0.77
4 0.78
5 0.78
6 0.78
7 0.79
8 0.8
9 0.8
10 0.81
11 0.8
12 0.8
13 0.8
14 0.72
15 0.69
16 0.58
17 0.51
18 0.43
19 0.4
20 0.32
21 0.28
22 0.28
23 0.2
24 0.21
25 0.18
26 0.2
27 0.18
28 0.17
29 0.16
30 0.17
31 0.22
32 0.21
33 0.2
34 0.17
35 0.25
36 0.28
37 0.31
38 0.3
39 0.26
40 0.31
41 0.34
42 0.37
43 0.29
44 0.29
45 0.32
46 0.4
47 0.46
48 0.47
49 0.44
50 0.42
51 0.41
52 0.41