Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EEW0

Protein Details
Accession H0EEW0   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-125EFERREEEKKVRKEKKFKEKLKELKKKTRTDVBasic
NLS Segment(s)
PositionSequence
98-122REEEKKVRKEKKFKEKLKELKKKTR
Subcellular Location(s) cyto_nucl 12.333, cyto 12, nucl 11.5, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR000465  XPA  
IPR022656  XPA_C  
IPR022658  XPA_CS  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF05181  XPA_C  
PROSITE View protein in PROSITE  
PS00753  XPA_2  
Amino Acid Sequences MEIDHVWLEVFGVAVCGKCKEKLPERYSLLTKTEAKDDYLLTDPELKDAELLPHLNKPNPHKSHWHDMMLFLRFQVEEYAFSTKWGSAAALDAEFERREEEKKVRKEKKFKEKLKELKKKTRTDVYRRNLQNGNKAGQFGDRIGGGKHEHEWGRTVENAEGETVKTCLECGMQVEELEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.12
4 0.14
5 0.16
6 0.22
7 0.29
8 0.39
9 0.48
10 0.51
11 0.58
12 0.61
13 0.65
14 0.63
15 0.58
16 0.51
17 0.47
18 0.47
19 0.39
20 0.39
21 0.34
22 0.32
23 0.3
24 0.27
25 0.24
26 0.23
27 0.21
28 0.17
29 0.21
30 0.2
31 0.2
32 0.2
33 0.16
34 0.14
35 0.14
36 0.14
37 0.11
38 0.13
39 0.12
40 0.17
41 0.2
42 0.22
43 0.26
44 0.31
45 0.39
46 0.42
47 0.44
48 0.47
49 0.51
50 0.58
51 0.58
52 0.55
53 0.45
54 0.44
55 0.45
56 0.38
57 0.32
58 0.21
59 0.17
60 0.13
61 0.13
62 0.12
63 0.08
64 0.07
65 0.09
66 0.13
67 0.12
68 0.13
69 0.13
70 0.11
71 0.11
72 0.1
73 0.08
74 0.05
75 0.06
76 0.06
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.07
84 0.08
85 0.1
86 0.13
87 0.21
88 0.29
89 0.39
90 0.49
91 0.57
92 0.65
93 0.74
94 0.8
95 0.84
96 0.86
97 0.85
98 0.84
99 0.85
100 0.87
101 0.88
102 0.88
103 0.86
104 0.86
105 0.86
106 0.83
107 0.8
108 0.79
109 0.77
110 0.77
111 0.79
112 0.75
113 0.75
114 0.7
115 0.7
116 0.67
117 0.61
118 0.6
119 0.54
120 0.51
121 0.42
122 0.41
123 0.35
124 0.3
125 0.28
126 0.19
127 0.16
128 0.13
129 0.13
130 0.12
131 0.15
132 0.14
133 0.14
134 0.16
135 0.2
136 0.21
137 0.21
138 0.24
139 0.23
140 0.25
141 0.26
142 0.26
143 0.22
144 0.22
145 0.21
146 0.19
147 0.18
148 0.15
149 0.15
150 0.13
151 0.11
152 0.1
153 0.1
154 0.09
155 0.1
156 0.1
157 0.11
158 0.15
159 0.16