Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E879

Protein Details
Accession A0A1Y2E879    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-123IRQKVAEKQTWRRRERFKKTLKAANTKLKEVKNEEKKVKRKRABasic
NLS Segment(s)
PositionSequence
91-123WRRRERFKKTLKAANTKLKEVKNEEKKVKRKRA
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MRNATNSLINQRRNVKGWRQLEKFEQDIQKEEAAKLREHEFNREFNTQWKFEFEKRELKAECQALKTEREQLQDNFPLSDIRQKVAEKQTWRRRERFKKTLKAANTKLKEVKNEEKKVKRKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.58
4 0.63
5 0.67
6 0.64
7 0.63
8 0.65
9 0.63
10 0.57
11 0.54
12 0.51
13 0.43
14 0.42
15 0.4
16 0.36
17 0.32
18 0.3
19 0.28
20 0.25
21 0.25
22 0.23
23 0.25
24 0.28
25 0.28
26 0.35
27 0.33
28 0.35
29 0.39
30 0.38
31 0.35
32 0.35
33 0.38
34 0.31
35 0.29
36 0.29
37 0.27
38 0.29
39 0.35
40 0.32
41 0.36
42 0.36
43 0.42
44 0.38
45 0.37
46 0.38
47 0.36
48 0.34
49 0.27
50 0.28
51 0.23
52 0.25
53 0.24
54 0.26
55 0.25
56 0.26
57 0.28
58 0.27
59 0.3
60 0.32
61 0.31
62 0.24
63 0.21
64 0.2
65 0.17
66 0.22
67 0.18
68 0.15
69 0.19
70 0.19
71 0.25
72 0.32
73 0.37
74 0.38
75 0.48
76 0.58
77 0.64
78 0.7
79 0.72
80 0.76
81 0.81
82 0.84
83 0.84
84 0.84
85 0.84
86 0.86
87 0.86
88 0.84
89 0.83
90 0.81
91 0.81
92 0.75
93 0.72
94 0.71
95 0.66
96 0.65
97 0.63
98 0.65
99 0.65
100 0.7
101 0.74
102 0.77
103 0.83