Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EVX7

Protein Details
Accession H0EVX7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
154-180KEKVEKYREGKEKDRIKKLEKESEKKDBasic
NLS Segment(s)
PositionSequence
156-179KVEKYREGKEKDRIKKLEKESEKK
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015222  Tam41  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0004605  F:phosphatidate cytidylyltransferase activity  
GO:0032049  P:cardiolipin biosynthetic process  
GO:0016024  P:CDP-diacylglycerol biosynthetic process  
Pfam View protein in Pfam  
PF09139  Tam41_Mmp37  
Amino Acid Sequences MGDPRMALPTEDKSKVANIVGNNLPNFRRLPDWALDPTLNARLTQDMSPIKRGNMVRRLPKFFRSKLYFQYQKKYQIPQLEFNKMLEASSDESGTRINRREGGGFEQRIASEPPEELRGEIRGVIKSTVSWPSTSQSLKGPVTAGAARTWRYMKEKVEKYREGKEKDRIKKLEKESEKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.31
4 0.27
5 0.21
6 0.26
7 0.29
8 0.32
9 0.3
10 0.31
11 0.29
12 0.28
13 0.28
14 0.24
15 0.23
16 0.22
17 0.25
18 0.25
19 0.29
20 0.29
21 0.31
22 0.29
23 0.27
24 0.26
25 0.26
26 0.24
27 0.19
28 0.17
29 0.16
30 0.18
31 0.18
32 0.21
33 0.22
34 0.24
35 0.3
36 0.3
37 0.28
38 0.32
39 0.35
40 0.38
41 0.41
42 0.46
43 0.49
44 0.54
45 0.61
46 0.58
47 0.63
48 0.62
49 0.56
50 0.59
51 0.56
52 0.53
53 0.52
54 0.59
55 0.6
56 0.55
57 0.61
58 0.57
59 0.6
60 0.6
61 0.57
62 0.52
63 0.51
64 0.51
65 0.51
66 0.51
67 0.47
68 0.43
69 0.39
70 0.36
71 0.28
72 0.24
73 0.16
74 0.12
75 0.1
76 0.09
77 0.09
78 0.08
79 0.08
80 0.09
81 0.1
82 0.12
83 0.12
84 0.13
85 0.16
86 0.17
87 0.18
88 0.19
89 0.23
90 0.27
91 0.25
92 0.25
93 0.23
94 0.22
95 0.22
96 0.21
97 0.16
98 0.1
99 0.1
100 0.1
101 0.12
102 0.12
103 0.11
104 0.11
105 0.11
106 0.11
107 0.13
108 0.14
109 0.13
110 0.14
111 0.14
112 0.13
113 0.13
114 0.15
115 0.18
116 0.17
117 0.16
118 0.16
119 0.18
120 0.23
121 0.23
122 0.22
123 0.21
124 0.26
125 0.25
126 0.25
127 0.24
128 0.19
129 0.22
130 0.22
131 0.19
132 0.16
133 0.18
134 0.19
135 0.21
136 0.22
137 0.23
138 0.28
139 0.32
140 0.38
141 0.45
142 0.53
143 0.6
144 0.67
145 0.71
146 0.71
147 0.75
148 0.77
149 0.73
150 0.72
151 0.72
152 0.73
153 0.75
154 0.8
155 0.78
156 0.76
157 0.79
158 0.8
159 0.81
160 0.81