Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F919

Protein Details
Accession A0A1Y2F919    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKRPTSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKRPTSNRYPSMKGVDPKFRRNLKYAQHGTQKAIRAARAEAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.84
8 0.82
9 0.77
10 0.75
11 0.73
12 0.7
13 0.67
14 0.64
15 0.59
16 0.53
17 0.51
18 0.5
19 0.47
20 0.44
21 0.43
22 0.46
23 0.45
24 0.47
25 0.53
26 0.54
27 0.53
28 0.53
29 0.56
30 0.54
31 0.6
32 0.6
33 0.59
34 0.62
35 0.61
36 0.6
37 0.58
38 0.56
39 0.5
40 0.47
41 0.42
42 0.35
43 0.35