Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FM40

Protein Details
Accession A0A1Y2FM40    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-47QEKPKTPKGRALKRIKYNRRFVTAHydrophilic
NLS Segment(s)
PositionSequence
11-42AGKVRGQTPKVAKQEKPKTPKGRALKRIKYNR
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRGQTPKVAKQEKPKTPKGRALKRIKYNRRFVTAATLVGGKRRMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.37
4 0.4
5 0.45
6 0.53
7 0.57
8 0.59
9 0.58
10 0.61
11 0.68
12 0.7
13 0.7
14 0.71
15 0.71
16 0.71
17 0.75
18 0.74
19 0.73
20 0.75
21 0.78
22 0.77
23 0.79
24 0.84
25 0.86
26 0.85
27 0.85
28 0.8
29 0.76
30 0.68
31 0.58
32 0.56
33 0.48
34 0.39
35 0.31
36 0.28
37 0.22
38 0.25
39 0.28
40 0.2
41 0.26
42 0.34
43 0.4