Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FYB6

Protein Details
Accession A0A1Y2FYB6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-103HGEMPACHRRRPKRPKLQQKNRQARBasic
NLS Segment(s)
PositionSequence
87-103RRRPKRPKLQQKNRQAR
Subcellular Location(s) mito_nucl 12.166, nucl 11.5, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MWTKLTRQNLPPSKDLPLQLPSTPHSTGMDTSSHGHDLNPQAEQPGKVQRCCGWNCDRRRSTWPLFGQHQKRSVIWLEHGEMPACHRRRPKRPKLQQKNRQAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.42
4 0.37
5 0.35
6 0.32
7 0.32
8 0.29
9 0.29
10 0.28
11 0.25
12 0.22
13 0.21
14 0.2
15 0.19
16 0.18
17 0.15
18 0.16
19 0.16
20 0.16
21 0.15
22 0.14
23 0.16
24 0.19
25 0.18
26 0.17
27 0.15
28 0.15
29 0.16
30 0.17
31 0.15
32 0.21
33 0.22
34 0.22
35 0.23
36 0.25
37 0.29
38 0.3
39 0.33
40 0.33
41 0.38
42 0.44
43 0.53
44 0.52
45 0.5
46 0.55
47 0.58
48 0.53
49 0.54
50 0.52
51 0.47
52 0.51
53 0.57
54 0.58
55 0.55
56 0.56
57 0.5
58 0.45
59 0.43
60 0.42
61 0.35
62 0.31
63 0.29
64 0.26
65 0.27
66 0.28
67 0.25
68 0.21
69 0.23
70 0.29
71 0.28
72 0.31
73 0.38
74 0.47
75 0.57
76 0.69
77 0.75
78 0.78
79 0.87
80 0.93
81 0.95
82 0.96
83 0.95