Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F1L1

Protein Details
Accession A0A1Y2F1L1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MCGHGRQRQQQERERERREKRRESEEKRRGLWBasic
NLS Segment(s)
PositionSequence
13-30RERERREKRRESEEKRRG
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MCGHGRQRQQQERERERREKRRESEEKRRGLWESRACHHASRPGPRSSSPIPIHTHPLIYTRHRPHPPLPCILRQAYRLMPCQVSSSFFQHTAPMFNIDTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.88
5 0.89
6 0.89
7 0.85
8 0.85
9 0.87
10 0.86
11 0.87
12 0.85
13 0.82
14 0.74
15 0.71
16 0.63
17 0.57
18 0.56
19 0.52
20 0.48
21 0.44
22 0.45
23 0.43
24 0.41
25 0.37
26 0.36
27 0.34
28 0.38
29 0.4
30 0.4
31 0.4
32 0.4
33 0.44
34 0.38
35 0.42
36 0.34
37 0.33
38 0.33
39 0.32
40 0.36
41 0.31
42 0.29
43 0.21
44 0.23
45 0.22
46 0.24
47 0.32
48 0.32
49 0.41
50 0.43
51 0.47
52 0.5
53 0.57
54 0.56
55 0.56
56 0.55
57 0.5
58 0.52
59 0.52
60 0.48
61 0.4
62 0.4
63 0.37
64 0.37
65 0.36
66 0.35
67 0.33
68 0.3
69 0.32
70 0.28
71 0.26
72 0.25
73 0.25
74 0.25
75 0.25
76 0.25
77 0.25
78 0.25
79 0.26
80 0.24
81 0.24