Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F6E9

Protein Details
Accession A0A1Y2F6E9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-76FFTVSGKMKKRRERAEAAKARAHydrophilic
NLS Segment(s)
PositionSequence
61-78KMKKRRERAEAAKARAGA
Subcellular Location(s) mito 9, plas 7, cyto 6, E.R. 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPALTNLEQLTALVKRQGDYIEGSGFKKQGNWAARNAGIVLVFCIAAVLILGVIFFTVSGKMKKRRERAEAAKARAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.16
4 0.17
5 0.15
6 0.16
7 0.17
8 0.17
9 0.18
10 0.19
11 0.19
12 0.19
13 0.18
14 0.17
15 0.17
16 0.21
17 0.26
18 0.27
19 0.27
20 0.29
21 0.3
22 0.28
23 0.27
24 0.19
25 0.13
26 0.1
27 0.08
28 0.05
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.04
45 0.07
46 0.12
47 0.2
48 0.29
49 0.39
50 0.48
51 0.58
52 0.65
53 0.71
54 0.78
55 0.8
56 0.82
57 0.83
58 0.79