Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FR94

Protein Details
Accession A0A1Y2FR94    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
95-114KFLAKKRSKSVLSDRQRRRKBasic
NLS Segment(s)
PositionSequence
90-114TWKGGKFLAKKRSKSVLSDRQRRRK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSIRSSTKMRFRAVKRKDRSIVEDQRLARLAARLAKRNNLATATNGAGEGDAAMETDGVLADAPKDTAMEVDTKKVSTSGSRGSARETWKGGKFLAKKRSKSVLSDRQRRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.77
4 0.74
5 0.78
6 0.79
7 0.75
8 0.74
9 0.74
10 0.73
11 0.68
12 0.67
13 0.58
14 0.55
15 0.5
16 0.43
17 0.34
18 0.25
19 0.22
20 0.22
21 0.26
22 0.29
23 0.3
24 0.35
25 0.37
26 0.37
27 0.36
28 0.32
29 0.29
30 0.23
31 0.23
32 0.19
33 0.16
34 0.14
35 0.12
36 0.09
37 0.08
38 0.06
39 0.04
40 0.03
41 0.03
42 0.03
43 0.02
44 0.02
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.05
58 0.09
59 0.09
60 0.12
61 0.13
62 0.13
63 0.13
64 0.14
65 0.14
66 0.12
67 0.16
68 0.18
69 0.24
70 0.26
71 0.27
72 0.31
73 0.35
74 0.37
75 0.37
76 0.36
77 0.36
78 0.37
79 0.39
80 0.36
81 0.39
82 0.43
83 0.48
84 0.55
85 0.57
86 0.58
87 0.63
88 0.71
89 0.66
90 0.67
91 0.68
92 0.68
93 0.7
94 0.77