Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F9B0

Protein Details
Accession A0A1Y2F9B0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-177ECDTESLSRKEKRRRKKLRTAATGAGHydrophilic
NLS Segment(s)
PositionSequence
160-171RKEKRRRKKLRT
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLLQRSKQQLNPTTPSRALVKSNLTSRTKRASFVDDTTPTKAACQYLLNTSTDLTTPMIDGSTSNSPAHTLAPPKAAPVMSAMTGIKLTPAAALAAATEASKIANANLKRAKAYLRSEAMRVAITSLDDIMYTNDFLLPGDTRKVSAVPVLECDTESLSRKEKRRRKKLRTAATGAGGLGKIGGSASSMDGDYSTGENEEFGVDRAGHGIGPSLEPLFSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.49
4 0.44
5 0.4
6 0.38
7 0.4
8 0.39
9 0.44
10 0.49
11 0.51
12 0.51
13 0.53
14 0.57
15 0.52
16 0.49
17 0.47
18 0.45
19 0.44
20 0.44
21 0.47
22 0.42
23 0.44
24 0.43
25 0.41
26 0.34
27 0.31
28 0.29
29 0.22
30 0.19
31 0.18
32 0.17
33 0.21
34 0.24
35 0.23
36 0.21
37 0.2
38 0.19
39 0.17
40 0.16
41 0.11
42 0.09
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.09
49 0.12
50 0.14
51 0.14
52 0.13
53 0.14
54 0.15
55 0.16
56 0.15
57 0.16
58 0.15
59 0.19
60 0.19
61 0.19
62 0.2
63 0.18
64 0.16
65 0.15
66 0.14
67 0.1
68 0.12
69 0.11
70 0.09
71 0.09
72 0.09
73 0.07
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.03
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.04
91 0.1
92 0.1
93 0.16
94 0.19
95 0.2
96 0.21
97 0.21
98 0.23
99 0.24
100 0.27
101 0.27
102 0.27
103 0.27
104 0.28
105 0.28
106 0.26
107 0.2
108 0.17
109 0.11
110 0.08
111 0.07
112 0.06
113 0.06
114 0.05
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.07
127 0.09
128 0.09
129 0.1
130 0.11
131 0.11
132 0.1
133 0.12
134 0.13
135 0.11
136 0.14
137 0.15
138 0.15
139 0.14
140 0.15
141 0.14
142 0.14
143 0.17
144 0.17
145 0.21
146 0.28
147 0.36
148 0.46
149 0.54
150 0.63
151 0.72
152 0.81
153 0.84
154 0.89
155 0.91
156 0.92
157 0.92
158 0.87
159 0.8
160 0.71
161 0.61
162 0.5
163 0.41
164 0.29
165 0.2
166 0.13
167 0.08
168 0.05
169 0.05
170 0.04
171 0.04
172 0.05
173 0.06
174 0.07
175 0.07
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.09
187 0.08
188 0.08
189 0.1
190 0.09
191 0.09
192 0.11
193 0.11
194 0.1
195 0.09
196 0.11
197 0.1
198 0.11
199 0.12
200 0.12