Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FVC2

Protein Details
Accession A0A1Y2FVC2    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MEQQVNKKPKQHTNTPQAKDHydrophilic
26-45AAAPRAKKEKKDPNAPKKALHydrophilic
NLS Segment(s)
PositionSequence
28-43APRAKKEKKDPNAPKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
Amino Acid Sequences MEQQVNKKPKQHTNTPQAKDSTTTRAAAPRAKKEKKDPNAPKKALSSYMLFTQDHRQIVLSENPGIPFGILPHLLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.75
4 0.67
5 0.6
6 0.53
7 0.46
8 0.42
9 0.34
10 0.3
11 0.26
12 0.28
13 0.3
14 0.32
15 0.35
16 0.38
17 0.46
18 0.51
19 0.54
20 0.59
21 0.67
22 0.69
23 0.74
24 0.75
25 0.75
26 0.8
27 0.77
28 0.7
29 0.63
30 0.57
31 0.49
32 0.4
33 0.32
34 0.23
35 0.25
36 0.25
37 0.22
38 0.22
39 0.25
40 0.28
41 0.26
42 0.25
43 0.22
44 0.2
45 0.24
46 0.27
47 0.23
48 0.21
49 0.22
50 0.22
51 0.22
52 0.21
53 0.18
54 0.13
55 0.11
56 0.12