Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FAQ3

Protein Details
Accession A0A1Y2FAQ3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-132LATKVDKASRQQRKQRKNREKKVRGTKKGKPASKKDKBasic
NLS Segment(s)
PositionSequence
102-132KASRQQRKQRKNREKKVRGTKKGKPASKKDK
Subcellular Location(s) mito 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDAITLRTRRFLTNRLLQRKQMIVDVLHPAKANASKAEVAEKLAQMYNVDKQAVSTFGFRTQFGGGKSTGFALIYDSVDALKKFEPHYRQVRVGLATKVDKASRQQRKQRKNREKKVRGTKKGKPASKKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.6
3 0.63
4 0.66
5 0.63
6 0.64
7 0.62
8 0.54
9 0.48
10 0.4
11 0.31
12 0.29
13 0.34
14 0.29
15 0.27
16 0.25
17 0.22
18 0.22
19 0.24
20 0.22
21 0.16
22 0.18
23 0.17
24 0.18
25 0.21
26 0.18
27 0.18
28 0.19
29 0.18
30 0.16
31 0.15
32 0.15
33 0.12
34 0.14
35 0.14
36 0.14
37 0.14
38 0.12
39 0.12
40 0.12
41 0.13
42 0.12
43 0.11
44 0.1
45 0.13
46 0.15
47 0.14
48 0.15
49 0.15
50 0.16
51 0.15
52 0.16
53 0.13
54 0.12
55 0.12
56 0.11
57 0.1
58 0.07
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.08
67 0.08
68 0.08
69 0.08
70 0.1
71 0.12
72 0.19
73 0.22
74 0.29
75 0.37
76 0.41
77 0.43
78 0.43
79 0.44
80 0.41
81 0.41
82 0.34
83 0.3
84 0.27
85 0.25
86 0.26
87 0.24
88 0.23
89 0.27
90 0.36
91 0.43
92 0.51
93 0.6
94 0.68
95 0.78
96 0.87
97 0.91
98 0.92
99 0.93
100 0.94
101 0.95
102 0.94
103 0.94
104 0.95
105 0.94
106 0.94
107 0.92
108 0.9
109 0.89
110 0.9
111 0.88
112 0.87