Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FU74

Protein Details
Accession A0A1Y2FU74   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MQRKLSGRPLRRPFKPNKEYEAHydrophilic
NLS Segment(s)
PositionSequence
119-119K
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR028124  SMAP_dom  
Pfam View protein in Pfam  
PF15477  SMAP  
Amino Acid Sequences MQRKLSGRPLRRPFKPNKEYEALFLNLPIDNADLSQIAKIEAERERKRLLRQETDVVAKRTRPSSTGAAGSWADGAASSLGEKSAKFMKLMGGGKAAGEVTTESLGAATDNKPDKAVKKARKAEAELEKQFKSGMQAKQSGSRRTGLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.81
4 0.78
5 0.75
6 0.69
7 0.62
8 0.57
9 0.47
10 0.37
11 0.31
12 0.24
13 0.17
14 0.16
15 0.14
16 0.09
17 0.07
18 0.07
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.1
28 0.15
29 0.24
30 0.27
31 0.31
32 0.36
33 0.39
34 0.45
35 0.5
36 0.52
37 0.5
38 0.5
39 0.52
40 0.49
41 0.52
42 0.5
43 0.45
44 0.39
45 0.33
46 0.31
47 0.29
48 0.27
49 0.22
50 0.22
51 0.22
52 0.23
53 0.23
54 0.2
55 0.2
56 0.19
57 0.18
58 0.13
59 0.1
60 0.07
61 0.05
62 0.05
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.06
71 0.1
72 0.11
73 0.11
74 0.12
75 0.13
76 0.19
77 0.21
78 0.2
79 0.17
80 0.16
81 0.16
82 0.16
83 0.14
84 0.07
85 0.06
86 0.06
87 0.05
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.07
95 0.06
96 0.12
97 0.15
98 0.15
99 0.17
100 0.2
101 0.23
102 0.31
103 0.4
104 0.44
105 0.52
106 0.61
107 0.67
108 0.71
109 0.72
110 0.71
111 0.71
112 0.71
113 0.68
114 0.64
115 0.57
116 0.5
117 0.46
118 0.38
119 0.35
120 0.33
121 0.32
122 0.34
123 0.39
124 0.41
125 0.5
126 0.57
127 0.56
128 0.51
129 0.48