Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FAE3

Protein Details
Accession A0A1Y2FAE3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-30GLKTFRRTAAKPKIEKKQAPVHydrophilic
NLS Segment(s)
PositionSequence
18-22AAKPK
Subcellular Location(s) mito 12, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021463  Methyltransf_34  
Pfam View protein in Pfam  
PF11312  Methyltransf_34  
Amino Acid Sequences MGSQHKRHEGLKTFRRTAAKPKIEKKQAPVELTPLQQAHRTLSQELLNALATLVAPQLEDMETFTAQLQQIKQHFFKRNYELVFQNSELCDVYAARYLPSRALAYADLFHSTKPVLDLLYPPPRAMRPSERRLQPAVQKREPVRITAVGAGVGSELCALQLLPRLRLAELDVDVDEDLIEVLDRDIEMDVIDNAAYAPFLSTLETSMADAFPPPKAKLGQCTLRYHQEDILQYGTTDAFAAMLSETTLLTFMFVFNELFAASRVDAMKLIEAIAKNLPAGAHVLLIESAGDLSEVQVADGTMMAGQGLEVPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.67
4 0.68
5 0.68
6 0.69
7 0.69
8 0.73
9 0.77
10 0.81
11 0.83
12 0.79
13 0.79
14 0.76
15 0.72
16 0.64
17 0.6
18 0.54
19 0.5
20 0.48
21 0.38
22 0.33
23 0.31
24 0.3
25 0.29
26 0.29
27 0.3
28 0.27
29 0.29
30 0.3
31 0.27
32 0.26
33 0.23
34 0.18
35 0.15
36 0.14
37 0.1
38 0.08
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.09
49 0.09
50 0.09
51 0.1
52 0.12
53 0.12
54 0.16
55 0.16
56 0.2
57 0.25
58 0.3
59 0.34
60 0.39
61 0.47
62 0.49
63 0.55
64 0.55
65 0.57
66 0.55
67 0.54
68 0.49
69 0.44
70 0.43
71 0.36
72 0.32
73 0.25
74 0.23
75 0.19
76 0.16
77 0.13
78 0.09
79 0.1
80 0.11
81 0.11
82 0.1
83 0.12
84 0.13
85 0.13
86 0.15
87 0.14
88 0.11
89 0.13
90 0.13
91 0.12
92 0.13
93 0.12
94 0.13
95 0.12
96 0.12
97 0.11
98 0.11
99 0.1
100 0.09
101 0.09
102 0.07
103 0.08
104 0.1
105 0.15
106 0.23
107 0.23
108 0.22
109 0.23
110 0.24
111 0.25
112 0.27
113 0.31
114 0.32
115 0.38
116 0.46
117 0.49
118 0.51
119 0.53
120 0.53
121 0.51
122 0.52
123 0.55
124 0.5
125 0.52
126 0.49
127 0.54
128 0.5
129 0.44
130 0.37
131 0.29
132 0.27
133 0.23
134 0.21
135 0.13
136 0.12
137 0.1
138 0.07
139 0.05
140 0.04
141 0.03
142 0.03
143 0.02
144 0.02
145 0.02
146 0.03
147 0.08
148 0.09
149 0.1
150 0.11
151 0.12
152 0.12
153 0.12
154 0.13
155 0.1
156 0.1
157 0.1
158 0.08
159 0.08
160 0.08
161 0.08
162 0.06
163 0.04
164 0.04
165 0.03
166 0.03
167 0.02
168 0.02
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.05
188 0.05
189 0.06
190 0.07
191 0.07
192 0.07
193 0.08
194 0.07
195 0.07
196 0.08
197 0.08
198 0.09
199 0.12
200 0.13
201 0.15
202 0.19
203 0.2
204 0.25
205 0.32
206 0.38
207 0.4
208 0.46
209 0.47
210 0.52
211 0.54
212 0.49
213 0.45
214 0.41
215 0.37
216 0.33
217 0.31
218 0.22
219 0.19
220 0.18
221 0.16
222 0.11
223 0.09
224 0.07
225 0.05
226 0.04
227 0.05
228 0.04
229 0.04
230 0.04
231 0.05
232 0.05
233 0.04
234 0.05
235 0.04
236 0.05
237 0.05
238 0.05
239 0.06
240 0.07
241 0.07
242 0.06
243 0.07
244 0.07
245 0.07
246 0.08
247 0.08
248 0.07
249 0.1
250 0.11
251 0.11
252 0.12
253 0.12
254 0.13
255 0.11
256 0.12
257 0.13
258 0.12
259 0.14
260 0.15
261 0.15
262 0.13
263 0.14
264 0.13
265 0.1
266 0.12
267 0.1
268 0.09
269 0.09
270 0.1
271 0.09
272 0.09
273 0.08
274 0.06
275 0.05
276 0.05
277 0.05
278 0.04
279 0.05
280 0.07
281 0.07
282 0.07
283 0.08
284 0.08
285 0.08
286 0.08
287 0.08
288 0.05
289 0.05
290 0.05
291 0.04
292 0.04