Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FH14

Protein Details
Accession A0A1Y2FH14   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
224-248VITRSPSPLKPSKRRPRPTPLCLASHydrophilic
NLS Segment(s)
PositionSequence
236-238KRR
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MGAFSFYHSSQMSHLMRRGSLTRANSIYGFIRSRQNSPGDLMFEVQGGDIQPLEDASPTAGLSPASASMRRCITSGSDLSASPTRGIFQEFPASPSTLNFGETRRNSIGAAAMLFIPRYNPERPDEYKRAHQHIFGGRASQFSPPDRPPPSPPATRTGRSPRREPMPRHLSATSQPDWVSSLSSPPALEEVKTPETDVPLSAWLQAEPIQWNNTALGGPLSSTVITRSPSPLKPSKRRPRPTPLCLASSSFIEIEKRSASMSSGSSAMYTQSSAVGSSTSESLYAQRSPMSPLAKRSFVARSGSAPLQYETKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.33
4 0.36
5 0.38
6 0.34
7 0.36
8 0.35
9 0.38
10 0.37
11 0.38
12 0.35
13 0.35
14 0.32
15 0.3
16 0.29
17 0.25
18 0.32
19 0.32
20 0.36
21 0.39
22 0.4
23 0.37
24 0.38
25 0.38
26 0.32
27 0.3
28 0.28
29 0.22
30 0.19
31 0.17
32 0.13
33 0.11
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.09
52 0.11
53 0.13
54 0.14
55 0.17
56 0.2
57 0.21
58 0.21
59 0.19
60 0.2
61 0.23
62 0.23
63 0.22
64 0.21
65 0.2
66 0.24
67 0.25
68 0.23
69 0.18
70 0.17
71 0.15
72 0.14
73 0.18
74 0.15
75 0.15
76 0.21
77 0.2
78 0.22
79 0.23
80 0.23
81 0.2
82 0.19
83 0.2
84 0.13
85 0.14
86 0.14
87 0.13
88 0.21
89 0.22
90 0.27
91 0.25
92 0.26
93 0.24
94 0.23
95 0.23
96 0.15
97 0.15
98 0.09
99 0.08
100 0.08
101 0.08
102 0.07
103 0.06
104 0.07
105 0.11
106 0.13
107 0.15
108 0.18
109 0.24
110 0.29
111 0.37
112 0.41
113 0.41
114 0.48
115 0.52
116 0.55
117 0.5
118 0.46
119 0.43
120 0.42
121 0.43
122 0.34
123 0.31
124 0.25
125 0.25
126 0.25
127 0.21
128 0.18
129 0.15
130 0.2
131 0.19
132 0.26
133 0.28
134 0.3
135 0.31
136 0.37
137 0.4
138 0.39
139 0.39
140 0.39
141 0.41
142 0.4
143 0.42
144 0.45
145 0.49
146 0.49
147 0.51
148 0.49
149 0.53
150 0.6
151 0.58
152 0.58
153 0.57
154 0.55
155 0.55
156 0.5
157 0.43
158 0.39
159 0.4
160 0.31
161 0.25
162 0.23
163 0.19
164 0.2
165 0.18
166 0.16
167 0.1
168 0.1
169 0.09
170 0.1
171 0.09
172 0.08
173 0.1
174 0.09
175 0.09
176 0.09
177 0.14
178 0.15
179 0.16
180 0.16
181 0.15
182 0.16
183 0.16
184 0.15
185 0.1
186 0.1
187 0.1
188 0.1
189 0.1
190 0.08
191 0.09
192 0.1
193 0.11
194 0.11
195 0.13
196 0.14
197 0.14
198 0.14
199 0.14
200 0.12
201 0.11
202 0.09
203 0.08
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.07
211 0.09
212 0.1
213 0.11
214 0.15
215 0.2
216 0.23
217 0.3
218 0.37
219 0.45
220 0.55
221 0.65
222 0.71
223 0.77
224 0.84
225 0.86
226 0.88
227 0.89
228 0.86
229 0.85
230 0.78
231 0.71
232 0.63
233 0.57
234 0.47
235 0.38
236 0.32
237 0.22
238 0.19
239 0.17
240 0.16
241 0.15
242 0.15
243 0.14
244 0.13
245 0.13
246 0.13
247 0.14
248 0.15
249 0.14
250 0.14
251 0.13
252 0.13
253 0.13
254 0.13
255 0.1
256 0.1
257 0.08
258 0.09
259 0.09
260 0.09
261 0.09
262 0.08
263 0.08
264 0.09
265 0.09
266 0.08
267 0.08
268 0.09
269 0.11
270 0.14
271 0.15
272 0.15
273 0.17
274 0.17
275 0.22
276 0.27
277 0.32
278 0.32
279 0.4
280 0.45
281 0.45
282 0.45
283 0.44
284 0.44
285 0.42
286 0.43
287 0.36
288 0.34
289 0.37
290 0.39
291 0.37
292 0.34
293 0.31