Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FFQ1

Protein Details
Accession A0A1Y2FFQ1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
46-72PLKPHNCHHCRRSFKRPQDLKKHIKTHBasic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences LYNHVCEDHIGRKSTGNLTLTCAWGTCTITTAKRDHITSHIRVHVPLKPHNCHHCRRSFKRPQDLKKHIKTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.31
4 0.26
5 0.28
6 0.29
7 0.27
8 0.24
9 0.2
10 0.16
11 0.15
12 0.16
13 0.11
14 0.11
15 0.12
16 0.14
17 0.17
18 0.18
19 0.2
20 0.21
21 0.22
22 0.21
23 0.25
24 0.28
25 0.29
26 0.32
27 0.32
28 0.3
29 0.31
30 0.32
31 0.29
32 0.28
33 0.31
34 0.34
35 0.35
36 0.41
37 0.5
38 0.54
39 0.59
40 0.62
41 0.65
42 0.69
43 0.72
44 0.77
45 0.78
46 0.82
47 0.85
48 0.88
49 0.88
50 0.89
51 0.91
52 0.91