Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F7L6

Protein Details
Accession A0A1Y2F7L6    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-32GLLWKTPWRMSQNRKFRQRERLRAVDTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MTRTSGLLWKTPWRMSQNRKFRQRERLRAVDTVITTLHDSLGAAGETCKALSRAVAENIPESEMLPKNKYTVFARGSEGYRKGVHKVPKFTRISTPREGPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.67
4 0.7
5 0.75
6 0.82
7 0.84
8 0.83
9 0.85
10 0.85
11 0.86
12 0.83
13 0.82
14 0.76
15 0.69
16 0.63
17 0.55
18 0.45
19 0.35
20 0.26
21 0.18
22 0.15
23 0.13
24 0.11
25 0.07
26 0.07
27 0.06
28 0.06
29 0.05
30 0.04
31 0.04
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.08
40 0.09
41 0.11
42 0.12
43 0.12
44 0.12
45 0.12
46 0.13
47 0.1
48 0.08
49 0.11
50 0.14
51 0.16
52 0.17
53 0.17
54 0.19
55 0.2
56 0.23
57 0.21
58 0.25
59 0.25
60 0.25
61 0.29
62 0.3
63 0.32
64 0.34
65 0.34
66 0.3
67 0.31
68 0.31
69 0.31
70 0.35
71 0.41
72 0.43
73 0.51
74 0.55
75 0.61
76 0.64
77 0.63
78 0.67
79 0.64
80 0.64
81 0.62
82 0.63
83 0.61